Home » NGEF » NGEF Antibodies » NGEF Antibody (6E7)

NGEF Antibody (6E7)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: NGEF Antibody (6E7) [H00025791-M01-100ug] - Detection against Immunogen (36.63 KDa).
Western Blot: NGEF Antibody (6E7) [H00025791-M01-100ug] - Detection against Immunogen (36.63 KDa).
ELISA: NGEF Antibody (6E7) [H00025791-M01-100ug] - Detection limit for recombinant GST tagged NGEF is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6E7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NGEF Antibody (6E7) Summary

Immunogen
NGEF (NP_062824.1, 612 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LDCPQVQCVHPYVAQQPDELTLELADILNILDKTDDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKDRRKLGSRNRQ
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NGEF
Purity
Protein A or G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NGEF Antibody (6E7)

  • EPHEXIN
  • ephexin-1
  • Eph-interacting exchange protein
  • neuronal guanine nucleotide exchange factorARHGEF27

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SOS2 Antibody
[Unconjugated]
AF6260
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line and 293T human embryonic kidney cell line. PVDF Membrane was probed with 2 µg/mL of Goat Anti-Human SOS2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6260) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for SOS2 at approximately 160 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
SOS1 Antibody
NBP2-94657
Western Blot: SOS1 Antibody [NBP2-94657] - Analysis of extracts of various cell lines, using SOS1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunocytochemistry/Immunofluorescence: SOS1 Antibody [NBP2-94657] - Analysis of rat heart using SOS1. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: SOS1 Antibody [NBP2-94657] - Analysis of rat brain using SOS1. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
RASGRF1 Antibody
NBP2-95233
Western Blot: RASGRF1 Antibody [NBP2-95233] - Analysis of extracts of mouse brain, using RASGRF1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure tim
Immunocytochemistry/Immunofluorescence: RASGRF1 Antibody [NBP2-95233] - Analysis of U2OS cells using RASGRF1. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: RASGRF1 Antibody [NBP2-95233] - Paraffin-embedded human stomach using RASGRF1.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
CDC42 Antibody
(JJ086-04)
NBP2-67895
Western Blot: CDC42 Antibody (JJ086-04) [NBP2-67895] - Western blot analysis of CDC42 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody (HA1001) at 1:5,000 dilution was used for 1 hour at room temperature. Positive control: Lane 1: Hela cell lysate Lane 2: HepG2 cell lysate Lane 3: Jurkat cell lysate
Immunohistochemistry-Paraffin: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of paraffin-embedded mouse pancreas tissue using anti-CDC42 antibody. Counter stained with hematoxylin.
Flow Cytometry: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of Hela cells with CDC42 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
Rhodopsin Antibody
(B630)
NBP2-25160
Immunohistochemistry: Rhodopsin Antibody (B630) [NBP2-25160] - Rhodopsin expression and the prevalence of rod photoreceptors in the canine retina. (A) Fluorescence micrographs showing rhodopsin expression (red) in the ABCA4+/+ (left), ABCA4+/- (middle), and ABCA4-/- (right) rod outer segments. Scale bar = 10 um. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.
Western Blot: Rhodopsin Antibody (B630) [NBP2-25160] - Western blot analyses of ABCA4 (above), GAPDH (middle), and RHO (below) protein levels in retinal tissue of dogs with the three different genotypes. Image collected and cropped by CiteAb from the following publication. 50 ug of protein samples were resolved by SDS-PAGE, transferred to nitrocellulose membrane, and immunoblotted with the following primary antibodies: ABCA4 (NBP1-30032, 1:1000) and Rhodopsin (NBP2-25160, 1:5000), followed by Anti-Mouse IgG horseradish peroxidase-conjugated secondary antibody (R&D Systems, HAF007, 1:5000. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (B630) [NBP2-25160] - High magnification confocal image of pig retinal section stained with NBP2-25160 (Green). Rhodopsin is most abundant in the rod outer segments (ROS) of retina, clearly localized in rod membranes. The rod inner segments (RIS) and rod nuclei in the outer nuclear layer (ONL) are also seen in this image. Nuclear DNA was stained with DAPI (blue).
(2 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
EphA4 Antibody
AF641
EphA4 was detected in immersion fixed frozen sections of embryonic rat rib cartilage primordium (E15) using 5 µg/mL Goat Anti-Mouse EphA4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF641) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(7 Publications)
Species: Mu
Applications: WB, IHC
RhoD Antibody
NBP1-58359
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Liver Tissue Observed Staining: Cytoplasm in sinusoids of liver Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Expos
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P
EphA1 Antibody
AF3034
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse EphA1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3034) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for EphA1 at approximately 113 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
EphA1 was detected in perfusion fixed frozen sections of mouse thymus using Goat Anti-Mouse EphA1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3034) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to thymic stromal cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
RhoA Antibody
NB100-91273
Western Blot: RhoA Antibody [NB100-91273] - Rat spinal cord lysate using Rabbit antibody to Transforming protein RhoA: whole serum at 1:2000 dilution. One single band is detected.
Immunocytochemistry/Immunofluorescence: RhoA Antibody [NB100-91273] - Rat trigeminal at 1:500 dilution using Rabbit antibody to Transforming protein RhoA: whole serum (NB100-91273, in red), Sheep antibody to extracellular, N-terminal part of Sortilin: whole serum (NB100-98771, in green), DAPI counter stained appearing in blue.
Immunohistochemistry: RhoA Antibody [NB100-91273] - IHC on rat brain (paraffin sections) using Rabbit antibody to RhoA at a concentration of 15 ug/ml, incubated overnight and developed with DAB Ni.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Cortactin Antibody
(SC61-08)
NBP2-67632
Western Blot: Cortactin Antibody (SC61-08) [NBP2-67632] - Western blot analysis of Cortactin on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti
Immunocytochemistry/Immunofluorescence: Cortactin Antibody (SC61-08) [NBP2-67632] - Staining Cortactin in PC-3M cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Cortactin Antibody (SC61-08) [NBP2-67632] - Analysis of paraffin-embedded mouse colon tissue using anti-Cortactin antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Rac1 Antibody
NB100-91266
Western Blot: Rac1 Antibody [NB100-91266] - WB on tissue lysates. Blocking: 1% LFDM for 30 min at RT; primary antibody dilution: 1:1000 incubated overnight at 4C.
Immunocytochemistry/Immunofluorescence: Rac1 Antibody [NB100-91266] - Mouse Brain (cerebral cortex). ICC/IF image submitted by a verified customer review.
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat spinal cord using Rabbit antibody to RAC1, RAC2 (100-150) at 1:1000 dilution. Pre-absorption of the antibody with the immunising peptide completely abolishes the immunostaining (not shown).
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
GEF-H1 Antibody
NBP2-21577
Western Blot: GEF-H1 Antibody [NBP2-21577] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with GEF-H1 antibody diluted at 1:4000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: GEF-H1 Antibody [NBP2-21577] - GEF-H1 antibody detects GEF-H1 protein at cytoskeleton and Golgi apparatus by immunofluorescent analysis. Sample: HeLa cells were fixed in ice-cold MeOH for 5 min. Green: GEF-H1 stained by GEF-H1 antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar= 10 um.
Immunohistochemistry-Paraffin: GEF-H1 Antibody [NBP2-21577] - GEF-H1 antibody detects GEF-H1 protein at cytoplasm by immunohistochemical analysis. Sample: Paraffin-embedded mouse brain. GEF-H1 stained by GEF-H1 antibody diluted at 1:1000. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
SLC2A4RG Antibody
(4C10)
H00056731-M02
Western Blot: SLC2A4RG Antibody (4C10) [H00056731-M02] - SLC2A4RG monoclonal antibody (M02), clone 4C10 Analysis of SLC2A4RG expression in HeLa.
Immunocytochemistry/Immunofluorescence: SLC2A4RG Antibody (4C10) [H00056731-M02] - Analysis of monoclonal antibody to SLC2A4RG on HeLa cell. Antibody concentration 10 ug/ml.
Species: Hu
Applications: WB, ELISA, ICC/IF
Vav-1 [p Tyr160]
Antibody (751411) [Un ...
MAB37861
Western blot shows lysates of Jurkat human acute T cell leukemia cell line untreated (-) or treated (+) with 1 mM Pervanadate (PV) for 5 minutes and 10 µg/mL Mouse Anti-Human CD3 epsilon Monoclonal Antibody (Catalog # MAB100) for 15 minutes. PVDF membrane was probed with 0.1 µg/mL of Mouse Anti-Human Phospho-Vav‑1 (Y160) Monoclonal Antibody (Catalog # MAB37861) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for Phospho-Vav‑1 (Y160) at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line untreated (-) or treated (+) with 1 mM Pervanadate (PV) for 5 minutes, loaded at 0.2 mg/mL. A specific band was detected for Human Phospho-Vav‑1 (Y160) at approximately 116 kDa (as indicated) using 1 µg/mL of Mouse Anti-HumanPhospho-Vav‑1 (Y160) Monoclonal Antibody (Catalog # MAB37861). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Vav‑1 phosphorylated at Y160 was detected in immersion fixed Jurkat human acute T cell leukemia cell line treated with (upper panel) or without (lower panel) Pervanadate using Mouse Anti-Human Phospho-Vav‑1 (Y160) Monoclonal Antibody (Catalog # MAB37861) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Publication)
Species: Hu
Applications: WB, Simple Western, ICC
FECH Antibody
NBP1-54841
Western Blot: FECH Antibody [NBP1-54841] - Mouse liver, heart and brain mitochondria extract, concentration 2 ug/ml.
Western Blot: FECH Antibody [NBP1-54841] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Species: Hu, Mu
Applications: WB
EPX Antibody
NBP2-13967
Western Blot: EPX Antibody [NBP2-13967] - Analysis in human cell line NB4.
Immunohistochemistry-Paraffin: EPX Antibody [NBP2-13967] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: EPX Antibody [NBP2-13967] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
beta Amyloid
Antibody (MOAB-2)
NBP2-13075
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of beta Amyloid on normal mouse brain (left) and 5xFAD mouse brain (right) using DAB with hematoxylin counterstain. The MOAB-2 antibody was used at 1:20 on normal mouse brain and at 1:400 on 5xFAD mouse brain.
Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Analysis of beta Amyloid (MOAB-2) antibody in (1) 100 pmole beta Amyloid 42, (2) 5xFAD mouse brain homogenate Repetition 1 and (3) 5xFAD mouse brain homogenate Repetition 2.
Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Western blot analysis in cell lysates from HEK-APP SWE/BACE1 cells probed with an antibody against the C-terminus of APP (Lanes 1 and 2) and beta Amyloid (MOAB-2, Lanes 3 and 4). Beta Amyloid (MOAB-2) does not detect APP (from PMID: 22423893).
(2 Reviews)
(32 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
KALRN Antibody
NB100-41371
Immunohistochemistry-Paraffin: KALRN Antibody [NB100-41371] - Negative Control showing staining of paraffin embedded Human Cortex, with no primary antibody.
Flow Cytometry: KALRN Antibody [NB100-41371] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunohistochemistry-Paraffin: KALRN Antibody [NB100-41371] - Staining of paraffin embedded Human Cortex. Antibody at 5 ug/mL. Heat induced antigen retrieval with citrate buffer pH 6, HRP-staining.
(1 Review)
(1 Publication)
Species: Rt, Ma
Applications: Flow, IHC, IHC-P, PEP-ELISA
HOXA13 Antibody
NBP3-04717
Western Blot: HOXA13 Antibody [NBP3-04717] - Analysis of extracts of various cell lines, using HOxA13 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Species: Hu, Mu, Rt
Applications: WB
NGEF Antibody (6E7)
H00025791-M01-100ug
NGEF Antibody (6E7)
Species: Hu
Applications: WB, ELISA

Publications for NGEF Antibody (H00025791-M01-100ug) (0)

There are no publications for NGEF Antibody (H00025791-M01-100ug).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NGEF Antibody (H00025791-M01-100ug) (0)

There are no reviews for NGEF Antibody (H00025791-M01-100ug). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NGEF Antibody (H00025791-M01-100ug) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional NGEF Products

Array H00025791-M01-100ug

Bioinformatics Tool for NGEF Antibody (H00025791-M01-100ug)

Discover related pathways, diseases and genes to NGEF Antibody (H00025791-M01-100ug). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NGEF Antibody (H00025791-M01-100ug)

Discover more about diseases related to NGEF Antibody (H00025791-M01-100ug).
 

Pathways for NGEF Antibody (H00025791-M01-100ug)

View related products by pathway.

PTMs for NGEF Antibody (H00025791-M01-100ug)

Learn more about PTMs related to NGEF Antibody (H00025791-M01-100ug).

Blogs on NGEF

There are no specific blogs for NGEF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NGEF Antibody (6E7) and receive a gift card or discount.


Bioinformatics

Gene Symbol NGEF
Entrez
OMIM
Uniprot