NGEF Antibody (6E7)

Images

 
Western Blot: NGEF Antibody (6E7) [H00025791-M01-100ug] - Detection against Immunogen (36.63 KDa).
ELISA: NGEF Antibody (6E7) [H00025791-M01-100ug] - Detection limit for recombinant GST tagged NGEF is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6E7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NGEF Antibody (6E7) Summary

Immunogen
NGEF (NP_062824.1, 612 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LDCPQVQCVHPYVAQQPDELTLELADILNILDKTDDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKDRRKLGSRNRQ
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NGEF
Purity
Protein A or G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NGEF Antibody (6E7)

  • EPHEXIN
  • ephexin-1
  • Eph-interacting exchange protein
  • neuronal guanine nucleotide exchange factorARHGEF27

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6260
Species: Hu
Applications: WB
NBP2-94657
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-95233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
AF641
Species: Mu
Applications: WB, IHC
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB100-91273
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-91266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-54841
Species: Hu, Mu
Applications: WB
NBP2-13967
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-41371
Species: Rt, Ma
Applications: Flow, IHC, IHC-P, PEP-ELISA
NBP3-04717
Species: Hu, Mu, Rt
Applications: WB
H00025791-M01-100ug
Species: Hu
Applications: WB, ELISA

Publications for NGEF Antibody (H00025791-M01-100ug) (0)

There are no publications for NGEF Antibody (H00025791-M01-100ug).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NGEF Antibody (H00025791-M01-100ug) (0)

There are no reviews for NGEF Antibody (H00025791-M01-100ug). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NGEF Antibody (H00025791-M01-100ug) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NGEF Products

Array H00025791-M01-100ug

Bioinformatics Tool for NGEF Antibody (H00025791-M01-100ug)

Discover related pathways, diseases and genes to NGEF Antibody (H00025791-M01-100ug). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NGEF Antibody (H00025791-M01-100ug)

Discover more about diseases related to NGEF Antibody (H00025791-M01-100ug).
 

Pathways for NGEF Antibody (H00025791-M01-100ug)

View related products by pathway.

PTMs for NGEF Antibody (H00025791-M01-100ug)

Learn more about PTMs related to NGEF Antibody (H00025791-M01-100ug).

Blogs on NGEF

There are no specific blogs for NGEF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NGEF Antibody (6E7) and receive a gift card or discount.

Bioinformatics

Gene Symbol NGEF
Entrez
OMIM
Uniprot