NFIC Antibody - BSA Free

Staining of human cell line SiHa shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NFIC Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NFIC Antibody - BSA Free (NBP3-25013) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein NFIC using the following amino acid sequence: QDPLKDLVSLACDPASQQPGPLNGSGQLKMPSHCLSAQMLAPP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFIC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NFIC Antibody - BSA Free

• CCAAT-binding transcription factor
• CTF5
• CTFCCAAT-box-binding transcription factor
• MGC20153
• NF1-C
• NFI
• NF-I
• NF-I/C
• NFI-C
• nuclear factor 1 C-type
• Nuclear factor 1/C
• nuclear factor I/C (CCAAT-binding transcription factor)
• Nuclear factor I/C
• TGGCA-binding protein

Background

Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFIC