Recombinant Human NFATC2IP Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NFATC2IP Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 138 of Human NFATC2IP full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG

Protein/Peptide Type
Recombinant Protein
Gene
NFATC2IP

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NFATC2IP Protein

  • 45 kDa NF-AT-interacting protein
  • ESC2
  • FLJ14639
  • MGC126790
  • MGC138387
  • NFATC2-interacting protein
  • NIP4545 kDa NFAT-interacting protein
  • Nuclear factor of activated T-cells, cytoplasmic 2-interacting protein
  • nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2interacting protein
  • RAD60

Background

NFATC2IP( AAH18311, 1 a.a. - 139 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-469
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB300-504
Species: Hu, Mu, Rt
Applications: WB, ChIP, GS, ICC/IF, IHC-Fr, IHC-P, IP, S-ELISA
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86887
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45374
Species: Hu
Applications: WB, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
H00006047-A01
Species: Hu
Applications: WB, ELISA
H00084901-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for NFATC2IP Recombinant Protein (H00084901-P01) (0)

There are no publications for NFATC2IP Recombinant Protein (H00084901-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFATC2IP Recombinant Protein (H00084901-P01) (0)

There are no reviews for NFATC2IP Recombinant Protein (H00084901-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NFATC2IP Recombinant Protein (H00084901-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NFATC2IP Products

Bioinformatics Tool for NFATC2IP Recombinant Protein (H00084901-P01)

Discover related pathways, diseases and genes to NFATC2IP Recombinant Protein (H00084901-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFATC2IP Recombinant Protein (H00084901-P01)

Discover more about diseases related to NFATC2IP Recombinant Protein (H00084901-P01).
 

Pathways for NFATC2IP Recombinant Protein (H00084901-P01)

View related products by pathway.

PTMs for NFATC2IP Recombinant Protein (H00084901-P01)

Learn more about PTMs related to NFATC2IP Recombinant Protein (H00084901-P01).

Blogs on NFATC2IP

There are no specific blogs for NFATC2IP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NFATC2IP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NFATC2IP