NFATC1/NFAT2 Antibody

Product Discontinued

NFATC1/NFAT2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to NFATC1 (nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1) The peptide sequence was selected from the C terminal of NFATC1. Peptide sequence LLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEI
• Predicted Species: Mouse (100%), Rat (100%), Canine (93%), Equine (91%), Guinea Pig (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFATC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against NFATC1 and was validated on Western blot.
• Theoretical MW: 100 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NFATC1/NFAT2 Antibody

• MGC138448
• NFAT transcription complex cytosolic component
• NFAT2
• NFAT2cytoplasmic 1
• NFATC
• NF-ATC
• NFATC1
• NF-ATc1
• nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1

Background

NFATC1 is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Different isoforms of this protein may regulate inducible expression of different cytokine genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFATC1
• Uniprot:
  • B5B2M5(Human)