NFATC1/NFAT2 Antibody

Images

 
Western Blot: NFATC1/NFAT2 Antibody [NBP1-69215] - COLO205 cells lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: NFATC1/NFAT2 Antibody [NBP1-69215] - Human Adult heart Observed Staining: Nuclear, Cytoplasmic Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NFATC1/NFAT2 Antibody Summary

Immunogen
Synthetic peptides corresponding to NFATC1 (nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1) The peptide sequence was selected from the C terminal of NFATC1. Peptide sequence LLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFATC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against NFATC1 and was validated on Western blot.
Theoretical MW
100 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NFATC1/NFAT2 Antibody

  • MGC138448
  • NFAT transcription complex cytosolic component
  • NFAT2
  • NFAT2cytoplasmic 1
  • NFATC
  • NF-ATC
  • NFATC1
  • NF-ATc1
  • nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1

Background

NFATC1 is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Different isoforms of this protein may regulate inducible expression of different cytokine genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB300-504
Species: Hu, Mu, Rt
Applications: WB, ChIP, GS, ICC/IF, IHC-Fr, IHC-P, IP, S-ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF5834
Species: Hu, Mu, Rt
Applications: WB
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-69215
Species: Hu
Applications: WB, IHC

Publications for NFATC1/NFAT2 Antibody (NBP1-69215) (0)

There are no publications for NFATC1/NFAT2 Antibody (NBP1-69215).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFATC1/NFAT2 Antibody (NBP1-69215) (0)

There are no reviews for NFATC1/NFAT2 Antibody (NBP1-69215). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NFATC1/NFAT2 Antibody (NBP1-69215) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NFATC1/NFAT2 Products

Bioinformatics Tool for NFATC1/NFAT2 Antibody (NBP1-69215)

Discover related pathways, diseases and genes to NFATC1/NFAT2 Antibody (NBP1-69215). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFATC1/NFAT2 Antibody (NBP1-69215)

Discover more about diseases related to NFATC1/NFAT2 Antibody (NBP1-69215).
 

Pathways for NFATC1/NFAT2 Antibody (NBP1-69215)

View related products by pathway.

PTMs for NFATC1/NFAT2 Antibody (NBP1-69215)

Learn more about PTMs related to NFATC1/NFAT2 Antibody (NBP1-69215).
 

Research Areas for NFATC1/NFAT2 Antibody (NBP1-69215)

Find related products by research area.

Blogs on NFATC1/NFAT2

There are no specific blogs for NFATC1/NFAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NFATC1/NFAT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFATC1
Entrez
Uniprot