NEUROD4 Antibody - BSA Free

Western Blot: NEUROD4 Antibody [NBP2-87903] - WB Suggested Anti-NEUROD4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Small Intestine

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NEUROD4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NEUROD4 Antibody - BSA Free (NBP2-87903) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NEUROD4. Peptide sequence: PHYPSSSLSSGHVHSTPFQAGTPRYDVPIDMSYDSYPHHGIGTQLNTVFT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NEUROD4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NEUROD4 Antibody - BSA Free

• ATH3BHLHA4
• ATH-3Protein atonal homolog 3
• Atoh3neurogenic differentiation factor 4
• bHLHa4ATOH3
• Class A basic helix-loop-helix protein 4
• MATH-3
• NeuroD4
• neurogenic differentiation 4

Background

NEUROD4 (neuronal differentiation 4), is a mediator of neuronal differentiation and is thought to act as a transcriptional activator. Disease and disorder research has been conducted in relation to NEUROD4 and neuronitis and neuroendocrine tumor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NEUROD4