Neuro D4 Antibody - BSA Free

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Neuro D4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Neuro D4 Antibody - BSA Free (NBP3-03649) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 295-414 of human Neuro D4 (NP_001128627.1). VIPNGYCDFCLGGSKKTGCPEDLISCADCGRSGHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCLRHLKEKASAYITLT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Neuro D4 Antibody - BSA Free

• BAF45B
• BRG1-associated factor 45B
• D4, zinc and double PHD fingers family 1NEUD4BAF45b
• MGC150428
• MGC150429
• neuro-d4 homolog
• neuro-d4
• zinc finger protein neuro-d4

Background

Conserved gene encoding a human 353 amino acid neural specific zinc finger protein which was designated neuro d4. A cysteine and histidine rich region of the C terminus distinguishes members of this family from other zinc finger proteins. The human and rat cDNAs are 93% identical and only 3 amino acid differences are observed between the proteins. Different alternatively spliced cDNAs can be observed. The gene has been mapped to chromosome 19 using chromosomal somatic cell hybrid panels.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPF1