Neurexophilin-3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Neurexophilin-3 Antibody [NBP3-17900] - Staining of human cell line CACO-2 shows localization to mitotic spindle & vesicles.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Neurexophilin-3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GPPGSEDPERDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPNRPNH
• Predicted Species: Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NXPH3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Neurexophilin-3 Antibody - BSA Free

• KIAA1159
• neurexophilin 3
• Neurexophilin3
• Neurexophilin-3
• NPH3
• NPH3neurexophilin-3
• NXPH3

Background

Neurexophilin 3 is involved in neurotransmission via alpha neurexines. Neurexophilin 3 is known to have interactions with ABL1, CRK, SRC, NCK1 and NRXN1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NXPH3