Recombinant Human NETO1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NETO1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 434-533 of Human NETO1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GSQLSSTKGSRSNLSTRDASILTEMPTQPGKPLIPPMNRRNILVMKHNYSQDAADACDIDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHESEYNTTRV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NETO1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NETO1 GST (N-Term) Protein

  • BCTL1
  • Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor classA domains protein 1
  • BTCL1
  • BTCL1BCTL1neuropilin and tolloid-like protein 1
  • FLJ41325
  • NETO1
  • neuropilin (NRP) and tolloid (TLL)-like 1

Background

This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis. Alternatively spliced transcript variants encoding distinct proteins have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3859
Species: Hu, Mu
Applications: IP, WB
NBP1-81567
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-56288
Species: Hu
Applications: ICC/IF, WB
NBP2-01625
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00000761-M02
Species: Hu, Mu
Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB
NBP3-16867
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-41211
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
H00006925-M03
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF3889
Species: Hu, Mu
Applications: WB
NB100-2832
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-67618
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
MAB163
Species: Hu
Applications: IHC, WB
NBP1-83483
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56537
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
H00081832-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for NETO1 Partial Recombinant Protein (H00081832-Q01) (0)

There are no publications for NETO1 Partial Recombinant Protein (H00081832-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NETO1 Partial Recombinant Protein (H00081832-Q01) (0)

There are no reviews for NETO1 Partial Recombinant Protein (H00081832-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NETO1 Partial Recombinant Protein (H00081832-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NETO1 Products

Bioinformatics Tool for NETO1 Partial Recombinant Protein (H00081832-Q01)

Discover related pathways, diseases and genes to NETO1 Partial Recombinant Protein (H00081832-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NETO1 Partial Recombinant Protein (H00081832-Q01)

Discover more about diseases related to NETO1 Partial Recombinant Protein (H00081832-Q01).
 

Pathways for NETO1 Partial Recombinant Protein (H00081832-Q01)

View related products by pathway.

Research Areas for NETO1 Partial Recombinant Protein (H00081832-Q01)

Find related products by research area.

Blogs on NETO1

There are no specific blogs for NETO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NETO1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NETO1