Nephronophthisis Antibody

Images

 
Immunohistochemistry-Paraffin: Nephronophthisis Antibody [NBP2-13672] - Staining of human fallopian tube shows cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nephronophthisis Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TVEDTNGSETGFRAWNVQSRGRIFLVSKPVLQINTVDVLTTMGAIPAGFR PSTLSQLLEEGNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPHP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Nephronophthisis Protein (NBP2-13672PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nephronophthisis Antibody

  • FLJ97602
  • JBTS4NPH1Juvenile nephronophthisis 1 protein
  • nephrocystin 1
  • nephrocystin-1
  • nephronophthisis 1 (juvenile)
  • SLSN1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-39059
Species: Hu
Applications: IHC, IHC-P
H00027130-P02
Species: Hu
NBP1-83543
Species: Hu
Applications: IHC, IHC-P
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-15309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5175
Species: Mu
Applications: WB, IHC
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
AF6270
Species: Hu
Applications: ICC
AF5098
Species: Hu, Mu, Rt
Applications: WB
NBP1-06590
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84403
Species: Hu
Applications: IHC, IHC-P
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Nephronophthisis Antibody (NBP2-13672) (0)

There are no publications for Nephronophthisis Antibody (NBP2-13672).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nephronophthisis Antibody (NBP2-13672) (0)

There are no reviews for Nephronophthisis Antibody (NBP2-13672). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Nephronophthisis Antibody (NBP2-13672) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nephronophthisis Products

Bioinformatics Tool for Nephronophthisis Antibody (NBP2-13672)

Discover related pathways, diseases and genes to Nephronophthisis Antibody (NBP2-13672). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nephronophthisis Antibody (NBP2-13672)

Discover more about diseases related to Nephronophthisis Antibody (NBP2-13672).
 

Pathways for Nephronophthisis Antibody (NBP2-13672)

View related products by pathway.

PTMs for Nephronophthisis Antibody (NBP2-13672)

Learn more about PTMs related to Nephronophthisis Antibody (NBP2-13672).

Blogs on Nephronophthisis

There are no specific blogs for Nephronophthisis, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nephronophthisis Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPHP1