NEK1 Antibody

Product Discontinued

NEK1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to NEK1(NIMA (never in mitosis gene a)-related kinase 1) The peptide sequence was selected from the middle region of NEK1. Peptide sequence ETEILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRITIQENEVSE.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NEK1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This is a rabbit polyclonal antibody against NEK1 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NEK1 Antibody

• DKFZp686D06121
• DKFZp686K12169
• EC 2.7.11
• EC 2.7.11.1
• KIAA1901MGC138800
• Never in mitosis A-related kinase 1
• NIMA (never in mitosis gene a)-related kinase 1
• NimA-related protein kinase 1
• NY-REN-55
• protein-serine/threonine kinase
• Renal carcinoma antigen NY-REN-55
• serine/threonine-protein kinase Nek1
• SRPS2

Background

NEK1 phosphorylates serines and threonines, but also appears to possess tyrosine kinase activity. NEK1 is implicated in the control of meiosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NEK1
• Uniprot:
  • Q96PY6(Human)