New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Recombinant Human NEDD9/CASL/HEF1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NEDD9/CASL/HEF1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 101-200 of Human NEDD9/CASL/HEF1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NEDD9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NEDD9/CASL/HEF1 GST (N-Term) Protein

  • Cas scaffolding protein family member 2
  • CAS2
  • CASL
  • CAS-LCASS2cas-like docking
  • CASLdJ49G10.2
  • CRK-associated substrate-related protein
  • dJ49G10.2 (Enhancer of Filamentation 1 (HEF1))
  • dJ761I2.1 (enhancer of filamentation (HEF1))
  • dJ761I2.1
  • enhancer of filamentation 1
  • HEF1
  • HEF1Crk-associated substrate related
  • NEDD9
  • NEDD-9
  • Neural precursor cell expressed developmentally down-regulated protein 9
  • neural precursor cell expressed, developmentally down-regulated 9
  • p105
  • Renal carcinoma antigen NY-REN-12

Background

NEDD9 - neural precursor cell expressed, developmentally down-regulated 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00001434-M08
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-31993
Species: Hu
Applications: IHC, IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-67627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38206
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP1-58200
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82455
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF5414
Species: Hu
Applications: Simple Western, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
NBP2-67427
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-84621
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03107
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-87462
Species: Ca, Hu
Applications: IHC, IHC-P, WB
H00057091-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00004739-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for NEDD9/CASL/HEF1 Partial Recombinant Protein (H00004739-Q01) (0)

There are no publications for NEDD9/CASL/HEF1 Partial Recombinant Protein (H00004739-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEDD9/CASL/HEF1 Partial Recombinant Protein (H00004739-Q01) (0)

There are no reviews for NEDD9/CASL/HEF1 Partial Recombinant Protein (H00004739-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NEDD9/CASL/HEF1 Partial Recombinant Protein (H00004739-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NEDD9/CASL/HEF1 Products

Bioinformatics Tool for NEDD9/CASL/HEF1 Partial Recombinant Protein (H00004739-Q01)

Discover related pathways, diseases and genes to NEDD9/CASL/HEF1 Partial Recombinant Protein (H00004739-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEDD9/CASL/HEF1 Partial Recombinant Protein (H00004739-Q01)

Discover more about diseases related to NEDD9/CASL/HEF1 Partial Recombinant Protein (H00004739-Q01).
 

Pathways for NEDD9/CASL/HEF1 Partial Recombinant Protein (H00004739-Q01)

View related products by pathway.

PTMs for NEDD9/CASL/HEF1 Partial Recombinant Protein (H00004739-Q01)

Learn more about PTMs related to NEDD9/CASL/HEF1 Partial Recombinant Protein (H00004739-Q01).

Blogs on NEDD9/CASL/HEF1

There are no specific blogs for NEDD9/CASL/HEF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NEDD9/CASL/HEF1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NEDD9