Ndufs4 Antibody [Alexa Fluor® 700]

Images

 

Product Details

Summary
Product Discontinued
View other related Ndufs4 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-35354AF700
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Ndufs4 Antibody [Alexa Fluor® 700] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human Ndufs4 (NP_002486.1).

Sequence:
MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFS4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Ndufs4 Antibody [Alexa Fluor® 700]

  • AQDQ
  • AQDQmitochondrial
  • CI-18 kDa
  • NADH dehydrogenase (ubiquinone) Fe-S protein 4 (18kD) (NADH-coenzyme Qreductase)
  • NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Qreductase)
  • NADH-coenzyme Q reductase, 18-KD
  • NADH-ubiquinone oxidoreductase 18 kDa subunit

Background

Ndufs4 encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), or NADH:ubiquinone oxidoreductase, the first multi-subunit enzyme complex of the mitochondrial respiratory chain. Complex I plays a vital role in cellular ATP production, the primary source of energy for many crucial processes in living cells. It removes electrons from NADH and passes them by a series of different protein-coupled redox centers to the electron acceptor ubiquinone. In well-coupled mitochondria, the electron flux leads to ATP generation via the building of a proton gradient across the inner membrane. Complex I is composed of at least 41 subunits, of which 7 are encoded by the mitochondrial genome and the remainder by nuclear genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31142
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-33074
Species: Hu, Mu, Ze
Applications: IHC,  IHC-P, KO, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46127
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KO, WB
NBP1-49846
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-49127
Species: Hu
Applications: IHC,  IHC-P
NBP1-85620
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-12681
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-97854
Species: Pm-Cm, Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-84475
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP3-48671
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47359
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB41051
Species: Hu, Mu
Applications: WB
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IP, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-88937
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for Ndufs4 Antibody (NBP3-35354AF700) (0)

There are no publications for Ndufs4 Antibody (NBP3-35354AF700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ndufs4 Antibody (NBP3-35354AF700) (0)

There are no reviews for Ndufs4 Antibody (NBP3-35354AF700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ndufs4 Antibody (NBP3-35354AF700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ndufs4 Products

Research Areas for Ndufs4 Antibody (NBP3-35354AF700)

Find related products by research area.

Blogs on Ndufs4

There are no specific blogs for Ndufs4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ndufs4 Antibody [Alexa Fluor® 700] and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFS4