NDUFS3 Antibody

Images

 
Western Blot: NDUFS3 Antibody [NBP1-85619] - Analysis in human cell line MCF-7.
Immunocytochemistry/ Immunofluorescence: NDUFS3 Antibody [NBP1-85619] - Immunofluorescent staining of human cell line MCF7 shows localization to nuclear bodies & mitochondria.
Immunohistochemistry-Paraffin: NDUFS3 Antibody [NBP1-85619] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFS3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NDUFS3 Protein (NBP1-85619PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFS3 Antibody

  • CI-30
  • CI-30kD
  • complex I 30kDa subunit
  • Complex I-30kD
  • EC 1.6.5.3
  • EC 1.6.99.3
  • EC 1.6.99.5
  • NADH dehydrogenase (ubiquinone) Fe-S protein 3 (30kD) (NADH-coenzyme Qreductase)
  • NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Qreductase)
  • NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  • NADH dehydrogenase-ubiquinone 30 kDa subunit
  • NADH-ubiquinone oxidoreductase 30 kDa subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90050
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004723-M01
Species: Hu, Rt
Applications: WB, ELISA, RNAi
NBP1-84475
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31142
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46127
Species: Hu
Applications: WB, IHC
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
NBP2-45645
Species: Hu
Applications: WB, IHC, IF
NBP1-87283
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31465
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85620
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90816
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33021
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00374291-P01
Species: Hu

Publications for NDUFS3 Antibody (NBP1-85619) (0)

There are no publications for NDUFS3 Antibody (NBP1-85619).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFS3 Antibody (NBP1-85619) (0)

There are no reviews for NDUFS3 Antibody (NBP1-85619). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFS3 Antibody (NBP1-85619) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFS3 Products

Bioinformatics Tool for NDUFS3 Antibody (NBP1-85619)

Discover related pathways, diseases and genes to NDUFS3 Antibody (NBP1-85619). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFS3 Antibody (NBP1-85619)

Discover more about diseases related to NDUFS3 Antibody (NBP1-85619).
 

Pathways for NDUFS3 Antibody (NBP1-85619)

View related products by pathway.

PTMs for NDUFS3 Antibody (NBP1-85619)

Learn more about PTMs related to NDUFS3 Antibody (NBP1-85619).

Blogs on NDUFS3

There are no specific blogs for NDUFS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFS3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFS3