NDUFC2 Antibody

Images

 
Western Blot: NDUFC2 Antibody [H00004718-D01P] - Analysis of NDUFC2 expression in mouse kidney.
Western Blot: NDUFC2 Antibody [H00004718-D01P] - Analysis of NDUFC2 expression in HepG2.
Western Blot: NDUFC2 Antibody [H00004718-D01P] - Analysis of NDUFC2 expression in transfected 293T cell line by NDUFC2 polyclonal antibody.Lane 1: NDUFC2 transfected lysate(14.20 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFC2 Antibody Summary

Immunogen
NDUFC2 (NP_004540.1, 1 a.a. - 119 a.a.) full-length human protein. MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR
Specificity
Reacts with NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFC2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFC2 Antibody

  • B14.5b
  • CI-B14.5b
  • complex I subunit B14.5b
  • Complex I-B14.5b
  • EDM5
  • HLC-1NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2 (14.5kD, B14.5b)
  • HOA
  • Human lung cancer oncogene 1 protein
  • Matrilin3
  • Matrilin-3
  • NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa
  • NADH dehydrogenase [ubiquinone] 1 subunit C2
  • NADHDH2
  • NADH-ubiquinone oxidoreductase subunit B14.5b
  • NDUFC2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1141
Species: Mu
Applications: WB, IHC, IP
NBP2-26161
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-90050
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6574
Species: Mu
Applications: WB
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB3934
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-49127
Species: Hu
Applications: IHC
NBP1-32146
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77177
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC, IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-17014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00004718-D01P
Species: Hu, Mu
Applications: WB

Publications for NDUFC2 Antibody (H00004718-D01P) (0)

There are no publications for NDUFC2 Antibody (H00004718-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFC2 Antibody (H00004718-D01P) (0)

There are no reviews for NDUFC2 Antibody (H00004718-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFC2 Antibody (H00004718-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFC2 Products

Bioinformatics Tool for NDUFC2 Antibody (H00004718-D01P)

Discover related pathways, diseases and genes to NDUFC2 Antibody (H00004718-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFC2 Antibody (H00004718-D01P)

Discover more about diseases related to NDUFC2 Antibody (H00004718-D01P).
 

Pathways for NDUFC2 Antibody (H00004718-D01P)

View related products by pathway.

PTMs for NDUFC2 Antibody (H00004718-D01P)

Learn more about PTMs related to NDUFC2 Antibody (H00004718-D01P).

Blogs on NDUFC2

There are no specific blogs for NDUFC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFC2
Entrez
Uniprot