NDUFB11 Antibody


Genetic Strategies: Western Blot: NDUFB11 Antibody [NBP1-83956] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: NDUFB11 Antibody [NBP1-83956] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: NDUFB11 Antibody [NBP1-83956] - Staining of human duodenum shows strong, granular cytoplasmic positivity in glandular cells.
Western Blot: NDUFB11 Antibody [NBP1-83956] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Genetic Strategies


Order Details

NDUFB11 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE
Specificity of human NDUFB11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NDUFB11 Protein (NBP1-83956PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NDUFB11 Antibody

  • complex I NP17.3 subunit
  • Complex I-ESSS
  • ESSS
  • FLJ20494
  • MGC111182
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
  • NADH-ubiquinone oxidoreductase ESSS subunit
  • Neuronal protein 17.3
  • Np15
  • NP17.3
  • P17.3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NDUFB11 Antibody (NBP1-83956) (0)

There are no publications for NDUFB11 Antibody (NBP1-83956).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB11 Antibody (NBP1-83956) (0)

There are no reviews for NDUFB11 Antibody (NBP1-83956). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFB11 Antibody (NBP1-83956) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for NDUFB11 Antibody (NBP1-83956)

Discover related pathways, diseases and genes to NDUFB11 Antibody (NBP1-83956). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFB11 Antibody (NBP1-83956)

Discover more about diseases related to NDUFB11 Antibody (NBP1-83956).

Pathways for NDUFB11 Antibody (NBP1-83956)

View related products by pathway.

PTMs for NDUFB11 Antibody (NBP1-83956)

Learn more about PTMs related to NDUFB11 Antibody (NBP1-83956).

Research Areas for NDUFB11 Antibody (NBP1-83956)

Find related products by research area.

Blogs on NDUFB11

There are no specific blogs for NDUFB11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NDUFB11 Antibody and receive a gift card or discount.


Gene Symbol NDUFB11