NDUFAF6 Antibody

Immunohistochemistry-Paraffin: NDUFAF6 Antibody [NBP2-14585] - Staining of human stomach shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: NDUFAF6 Antibody [NBP2-14585] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: NDUFAF6 Antibody [NBP2-14585] - Staining of human kidney shows strong membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: NDUFAF6 Antibody [NBP2-14585] - Staining of human liver shows strong membranous positivity in hepatocytes.

Product Discontinued

NDUFAF6 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LAQVKDSVSEKTIGLMRMQFWKKTVEDIYCDNPPHQPVAIELWKAVKRHNLTKRWLMKIVDEREKNLDDKAYRNIKELENYA
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFAF6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NDUFAF6 Antibody

• C8orf38
• NDUFAF6 NADH dehydrogenase (ubiquinone) complex I, assembly factor 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFAF6