NDUFAF6 Antibody

Images

 
Immunohistochemistry-Paraffin: NDUFAF6 Antibody [NBP2-14585] - Staining of human stomach shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: NDUFAF6 Antibody [NBP2-14585] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: NDUFAF6 Antibody [NBP2-14585] - Staining of human kidney shows strong membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: NDUFAF6 Antibody [NBP2-14585] - Staining of human liver shows strong membranous positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFAF6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: LAQVKDSVSEKTIGLMRMQFWKKTVEDIYCDNPPHQPVAIELWKAVKRHNLTKRWLMKIVDEREKNLDDKAYRNIKELENYA
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFAF6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDUFAF6 Protein (NBP2-14585PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFAF6 Antibody

  • C8orf38
  • NDUFAF6 NADH dehydrogenase (ubiquinone) complex I, assembly factor 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89382
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-15644
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83180
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47359
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94462
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93264
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91858
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88935
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1457
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-01360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-00820
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00004704-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-84503
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00004722-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, KD, WB
NBP2-46127
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KO, WB
NBP2-14585
Species: Hu, Mu
Applications: IHC

Publications for NDUFAF6 Antibody (NBP2-14585) (0)

There are no publications for NDUFAF6 Antibody (NBP2-14585).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFAF6 Antibody (NBP2-14585) (0)

There are no reviews for NDUFAF6 Antibody (NBP2-14585). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NDUFAF6 Antibody (NBP2-14585) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFAF6 Products

Diseases for NDUFAF6 Antibody (NBP2-14585)

Discover more about diseases related to NDUFAF6 Antibody (NBP2-14585).
 

Pathways for NDUFAF6 Antibody (NBP2-14585)

View related products by pathway.

PTMs for NDUFAF6 Antibody (NBP2-14585)

Learn more about PTMs related to NDUFAF6 Antibody (NBP2-14585).

Blogs on NDUFAF6

There are no specific blogs for NDUFAF6, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFAF6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFAF6