NDUFAF4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NDUFAF4 Antibody [NBP1-92171] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: NDUFAF4 Antibody [NBP1-92171] - Staining of human prostate shows moderate membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFAF4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK
Specificity
Specificity of human NDUFAF4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFAF4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NDUFAF4 Protein (NBP1-92171PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFAF4 Antibody

  • bA22L21.1
  • C6orf66chromosome 6 open reading frame 66
  • Hormone-regulated proliferation-associated protein of 20 kDa
  • hormone-regulated proliferation-associated protein, 20 kDa
  • HRPAP20HSPC125
  • My013
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 4
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89382
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
MAB7947
Species: Hu, Mu, Rt
Applications: IHC
NB100-40853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85619
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46127
Species: Hu
Applications: WB, IHC
H00201562-D01P
Species: Hu
Applications: WB, ELISA
NBP1-70452
Species: Hu
Applications: WB
NBP1-84988
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-14964
Species: Hu
NBP2-58286
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92171
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NDUFAF4 Antibody (NBP1-92171) (0)

There are no publications for NDUFAF4 Antibody (NBP1-92171).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFAF4 Antibody (NBP1-92171) (0)

There are no reviews for NDUFAF4 Antibody (NBP1-92171). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NDUFAF4 Antibody (NBP1-92171) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFAF4 Products

Bioinformatics Tool for NDUFAF4 Antibody (NBP1-92171)

Discover related pathways, diseases and genes to NDUFAF4 Antibody (NBP1-92171). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFAF4 Antibody (NBP1-92171)

Discover more about diseases related to NDUFAF4 Antibody (NBP1-92171).
 

Pathways for NDUFAF4 Antibody (NBP1-92171)

View related products by pathway.

PTMs for NDUFAF4 Antibody (NBP1-92171)

Learn more about PTMs related to NDUFAF4 Antibody (NBP1-92171).

Blogs on NDUFAF4

There are no specific blogs for NDUFAF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFAF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFAF4