PTPLB Antibody - Azide and BSA Free

Western Blot: PTPLB Antibody [H00201562-D01P] - Analysis of PTPLB expression in transfected 293T cell line by PTPLB polyclonal antibody.Lane 1: PTPLB transfected lysate(28.40 KDa).Lane 2: Non-transfected lysate.

Western Blot: PTPLB Antibody [H00201562-D01P] - PTPLB MaxPab rabbit polyclonal antibody. Western Blot analysis of PTPLB expression in human kidney.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PTPLB Antibody - Azide and BSA Free Summary

• Immunogen: PTPLB (NP_940684.1, 1 a.a. - 254 a.a.) full-length human protein. MAAVAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGLVRAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQRRKILSHTEEHKKFE
• Specificity: Reacts with protein tyrosine phosphatase-like (proline instead of catalytic arginine), member b.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTPLB
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTPLB Antibody - Azide and BSA Free

• EC 4.2.1.-
• HACD2,3-hydroxyacyl-CoA dehydratase 2
• member b
• protein tyrosine phosphatase-like (proline instead of catalytic arginine)
• Protein-tyrosine phosphatase-like member B

Background

PTPLB, also known as Protein-Tyrosine Phosphatase-Like Member B, is a short, 254 amino acid long protein that is approximately 28kDa. PTPLB localizes to the membrane of the Endoplasmic Reticulum and is ubiquitously expressed in a variety of tissues including heart, spleen, prostate, colon, and testes. PTPLB is involved in VLCFA synthesis and interacts with BCAP31 and members of the ELOVL family of enzymes. Current research on PTPLB is being performed in relation to several diseases and disorders including malaria and prostatitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTPLB
• Entrez:
  • 201562(Human)
• Uniprot:
  • NP_940684.1(Human)