Recombinant Human NDUFA8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NDUFA8 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 72 of Human NDUFA8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR

Protein/Peptide Type
Partial Recombinant Protein
Gene
NDUFA8

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NDUFA8 Protein

  • CI-19KD
  • CI-PGIV
  • complex I PGIV subunit
  • Complex I-19kD
  • Complex I-PGIV
  • MGC793
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8 (19kD, PGIV)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
  • NADH:ubiquinone oxidoreductase PGIV subunit
  • NADH-ubiquinone oxidoreductase 19 kDa subunit
  • PGIV

Background

The protein encoded by this gene belongs to the complex I 19 kDA subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00374291-P01
Species: Hu
NBP1-31142
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00004723-M01
Species: Hu, Rt
Applications: WB, ELISA, RNAi
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
AF3014
Species: Hu
Applications: WB, IHC, Block
NBP1-92170
Species: Hu
Applications: WB, IHC, IHC-P
AF2667
Species: Hu
Applications: WB, IHC
NBP1-88933
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00002954-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-88938
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46127
Species: Hu
Applications: WB, IHC
NBP2-19506
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-87456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NDUFA8 Partial Recombinant Protein (H00004702-Q01) (0)

There are no publications for NDUFA8 Partial Recombinant Protein (H00004702-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA8 Partial Recombinant Protein (H00004702-Q01) (0)

There are no reviews for NDUFA8 Partial Recombinant Protein (H00004702-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFA8 Partial Recombinant Protein (H00004702-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NDUFA8 Products

Bioinformatics Tool for NDUFA8 Partial Recombinant Protein (H00004702-Q01)

Discover related pathways, diseases and genes to NDUFA8 Partial Recombinant Protein (H00004702-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFA8 Partial Recombinant Protein (H00004702-Q01)

Discover more about diseases related to NDUFA8 Partial Recombinant Protein (H00004702-Q01).
 

Pathways for NDUFA8 Partial Recombinant Protein (H00004702-Q01)

View related products by pathway.

PTMs for NDUFA8 Partial Recombinant Protein (H00004702-Q01)

Learn more about PTMs related to NDUFA8 Partial Recombinant Protein (H00004702-Q01).

Blogs on NDUFA8

There are no specific blogs for NDUFA8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NDUFA8 Antibody
NBP1-82662

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NDUFA8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFA8