NDUFA7 Antibody

Images

 
Western Blot: NDUFA7 Antibody [NBP2-57928] - Western blot analysis in human cell line RT-4.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NDUFA7 Antibody [NBP2-57928] - Staining in human heart muscle and pancreas tissues using anti-NDUFA7 antibody. Corresponding NDUFA7 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: NDUFA7 Antibody [NBP2-57928] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: NDUFA7 Antibody [NBP2-57928] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

NDUFA7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL
Specificity
Specificity of human NDUFA7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFA7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
NDUFA7 Knockout 293T Cell Lysate
Control Peptide
NDUFA7 Recombinant Protein Antigen (NBP2-57928PEP)

Reactivity Notes

Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NDUFA7 Antibody

  • B14.5a
  • CI-B14.5a
  • complex I B14.5a subunit
  • Complex I-B14.5a
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7 (14.5kD, B14.5a)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
  • NADH-ubiquinone oxidoreductase subunit B14.5a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3357
Species: Mu
Applications: WB
NBP1-90050
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32146
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75586
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-93743
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-85620
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-93398
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF1457
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC, KO
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-83956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for NDUFA7 Antibody (NBP2-57928) (0)

There are no publications for NDUFA7 Antibody (NBP2-57928).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA7 Antibody (NBP2-57928) (0)

There are no reviews for NDUFA7 Antibody (NBP2-57928). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFA7 Antibody (NBP2-57928) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NDUFA7 Products

Bioinformatics Tool for NDUFA7 Antibody (NBP2-57928)

Discover related pathways, diseases and genes to NDUFA7 Antibody (NBP2-57928). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFA7 Antibody (NBP2-57928)

Discover more about diseases related to NDUFA7 Antibody (NBP2-57928).
 

Pathways for NDUFA7 Antibody (NBP2-57928)

View related products by pathway.

PTMs for NDUFA7 Antibody (NBP2-57928)

Learn more about PTMs related to NDUFA7 Antibody (NBP2-57928).

Blogs on NDUFA7

There are no specific blogs for NDUFA7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFA7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFA7