NDUFA7 Antibody - BSA Free

Western Blot: NDUFA7 Antibody [NBP2-57928] - Western blot analysis in human cell line RT-4.

Immunohistochemistry-Paraffin: NDUFA7 Antibody [NBP2-57928] - Staining in human heart muscle and pancreas tissues using anti-NDUFA7 antibody. Corresponding NDUFA7 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NDUFA7 Antibody [NBP2-57928] - Staining of human heart muscle shows high expression.

Immunohistochemistry-Paraffin: NDUFA7 Antibody [NBP2-57928] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDUFA7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NDUFA7 Antibody - BSA Free (NBP2-57928) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFA7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NDUFA7 Recombinant Protein Antigen (NBP2-57928PEP)

Reactivity Notes

Rat 88%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NDUFA7 Antibody - BSA Free

• B14.5a
• CI-B14.5a
• complex I B14.5a subunit
• Complex I-B14.5a
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7 (14.5kD, B14.5a)
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa
• NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
• NADH-ubiquinone oxidoreductase subunit B14.5a

Background

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFA7