NDUFA7 Antibody

Images

 
Western Blot: NDUFA7 Antibody [NBP2-31758] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line HEK 293
Immunocytochemistry/ Immunofluorescence: NDUFA7 Antibody [NBP2-31758] - Immunofluorescent staining of human cell line PC-3 shows localization to mitochondria.
Immunohistochemistry-Paraffin: NDUFA7 Antibody [NBP2-31758] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFA7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFA7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NDUFA7 Protein (NBP2-31758PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFA7 Antibody

  • B14.5a
  • CI-B14.5a
  • complex I B14.5a subunit
  • Complex I-B14.5a
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7 (14.5kD, B14.5a)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
  • NADH-ubiquinone oxidoreductase subunit B14.5a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88934
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90050
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32146
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88859
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85620
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004700-R01
Species: Hu
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1457
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-83956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for NDUFA7 Antibody (NBP2-31758) (0)

There are no publications for NDUFA7 Antibody (NBP2-31758).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA7 Antibody (NBP2-31758) (0)

There are no reviews for NDUFA7 Antibody (NBP2-31758). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFA7 Antibody (NBP2-31758) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFA7 Products

Bioinformatics Tool for NDUFA7 Antibody (NBP2-31758)

Discover related pathways, diseases and genes to NDUFA7 Antibody (NBP2-31758). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFA7 Antibody (NBP2-31758)

Discover more about diseases related to NDUFA7 Antibody (NBP2-31758).
 

Pathways for NDUFA7 Antibody (NBP2-31758)

View related products by pathway.

PTMs for NDUFA7 Antibody (NBP2-31758)

Learn more about PTMs related to NDUFA7 Antibody (NBP2-31758).

Blogs on NDUFA7

There are no specific blogs for NDUFA7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFA7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFA7
Uniprot