NDUFA5 Antibody (H00004698-B01P)

Images

 
Western Blot: NDUFA5 Antibody [H00004698-B01P] - Analysis of NDUFA5 expression in transfected 293T cell line by NDUFA5 polyclonal antibody. Lane 1: NDUFA5 transfected lysate(12.76 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NDUFA5 Antibody Summary

Immunogen
NDUFA5 (NP_004991.1, 1 a.a. - 116 a.a.) full-length human protein. MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NDUFA5
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFA5 Antibody

  • B13,5 (13kD, B13)
  • DKFZp781K1356
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa
  • UQOR13FLJ12147

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-83552
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81576
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88930
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88929
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88941
Species: Hu
Applications: IHC, IHC-P
NBP1-92170
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004698-B01P
Species: Hu
Applications: WB

Publications for NDUFA5 Antibody (H00004698-B01P) (0)

There are no publications for NDUFA5 Antibody (H00004698-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA5 Antibody (H00004698-B01P) (0)

There are no reviews for NDUFA5 Antibody (H00004698-B01P). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFA5 Antibody (H00004698-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFA5 Products

Related Products by Gene

Bioinformatics Tool for NDUFA5 Antibody (H00004698-B01P)

Discover related pathways, diseases and genes to NDUFA5 Antibody (H00004698-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFA5 Antibody (H00004698-B01P)

Discover more about diseases related to NDUFA5 Antibody (H00004698-B01P).
 

Pathways for NDUFA5 Antibody (H00004698-B01P)

View related products by pathway.

PTMs for NDUFA5 Antibody (H00004698-B01P)

Learn more about PTMs related to NDUFA5 Antibody (H00004698-B01P).

Blogs on NDUFA5

There are no specific blogs for NDUFA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFA5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFA5
Uniprot