Recombinant Human NDST4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NDST4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 122-214 of Human NDST4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DNGKGKYTLVIYENILKYVSMDSWNRELLEKYCVEYSVSIIGFHKANENSLPSTQLKGFPLNLFNNLALKDCFVNPQSPLLHITKAPKVEKGP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NDST4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NDST4 Protein

  • bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4
  • EC 2.8.2.8
  • Glucosaminyl N-deacetylase/N-sulfotransferase 4
  • HSST4
  • N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4
  • NDST-4
  • N-heparan sulfate sulfotransferase 4
  • N-HSST 4
  • NHSST4

Background

NDST4 - N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-13645
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6174
Species: Hu
Applications: WB, IHC, IP
NBP2-49216
Species: Hu
Applications: ICC/IF, IHC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
H00010849-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00064579-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for NDST4 Partial Recombinant Protein (H00064579-Q01) (0)

There are no publications for NDST4 Partial Recombinant Protein (H00064579-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDST4 Partial Recombinant Protein (H00064579-Q01) (0)

There are no reviews for NDST4 Partial Recombinant Protein (H00064579-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDST4 Partial Recombinant Protein (H00064579-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NDST4 Products

Bioinformatics Tool for NDST4 Partial Recombinant Protein (H00064579-Q01)

Discover related pathways, diseases and genes to NDST4 Partial Recombinant Protein (H00064579-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDST4 Partial Recombinant Protein (H00064579-Q01)

Discover more about diseases related to NDST4 Partial Recombinant Protein (H00064579-Q01).
 

Pathways for NDST4 Partial Recombinant Protein (H00064579-Q01)

View related products by pathway.

PTMs for NDST4 Partial Recombinant Protein (H00064579-Q01)

Learn more about PTMs related to NDST4 Partial Recombinant Protein (H00064579-Q01).

Blogs on NDST4

There are no specific blogs for NDST4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NDST4 Antibody
NBP1-86481
BMP-2 [Unconjugated]
355-BM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NDST4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NDST4