Recombinant Human NDFIP2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NDFIP2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-242 of Human NDFIP2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDHHQPGTGRYQVLLNEEDNSESSAIEQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
NDFIP2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NDFIP2 Protein

  • FLJ25842
  • KIAA1165N4WBP5APutative MAPK-activating protein PM04/PM05/PM06/PM07
  • MAPK-activating protein PM04 PM05 PM06 PM07
  • N4wbp5a
  • Nedd4 family interacting protein 2
  • NEDD4 family-interacting protein 2
  • NEDD4 WW domain-binding protein 5A
  • NF-kappa-B-activating protein 413
  • Putative NF-kappa-B-activating protein 413

Background

NDFIP2( AAH21988, 1 a.a. - 243 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8246
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27201
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
NBP1-54974
Species: Hu
Applications: WB
NBP1-49942
Species: Hu, Mu
Applications: WB, IP
NBP1-89722
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000343-M01
Species: Hu, Rt
Applications: WB, ELISA
NB600-1151
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-68142
Species: Hu
Applications: WB, PEP-ELISA
NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
H00004891-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-19010
Species: Hu
Applications: WB, IHC, IHC-P
MAB7509
Species: Hu
Applications: WB, IHC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NLS7240
Species: Hu, Mu, Rt, Bt, Ca, Ha
Applications: IHC-P
H00054602-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for NDFIP2 Recombinant Protein (H00054602-P01) (0)

There are no publications for NDFIP2 Recombinant Protein (H00054602-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDFIP2 Recombinant Protein (H00054602-P01) (0)

There are no reviews for NDFIP2 Recombinant Protein (H00054602-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDFIP2 Recombinant Protein (H00054602-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NDFIP2 Products

Bioinformatics Tool for NDFIP2 Recombinant Protein (H00054602-P01)

Discover related pathways, diseases and genes to NDFIP2 Recombinant Protein (H00054602-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDFIP2 Recombinant Protein (H00054602-P01)

Discover more about diseases related to NDFIP2 Recombinant Protein (H00054602-P01).
 

Pathways for NDFIP2 Recombinant Protein (H00054602-P01)

View related products by pathway.

PTMs for NDFIP2 Recombinant Protein (H00054602-P01)

Learn more about PTMs related to NDFIP2 Recombinant Protein (H00054602-P01).
 

Research Areas for NDFIP2 Recombinant Protein (H00054602-P01)

Find related products by research area.

Blogs on NDFIP2

There are no specific blogs for NDFIP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF
NDFIP2 Antibody
NBP1-81436

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NDFIP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NDFIP2