NDFIP2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

NDFIP2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NDFIP2.
  
  

  Source: E.coli

  Amino Acid Sequence: AAAGATGSEELPPGDRGCRNGGGRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDN

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: NDFIP2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This peptide is useful as a blocking peptide for NBP1-81436.
  Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.
  
  For further blocking peptide related information and a protocol, click here.
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for NDFIP2 Recombinant Protein Antigen

• FLJ25842
• KIAA1165N4WBP5APutative MAPK-activating protein PM04/PM05/PM06/PM07
• MAPK-activating protein PM04 PM05 PM06 PM07
• N4wbp5a
• Nedd4 family interacting protein 2
• NEDD4 family-interacting protein 2
• NEDD4 WW domain-binding protein 5A
• NF-kappa-B-activating protein 413
• Putative NF-kappa-B-activating protein 413

Background

NDFIP2, also known as NEDD4 family-interacting protein 2, NEDD4 WW domain-binding protein 5A, putative MAPK-activating protein PM04/PM05/PM06/PM07 and putative NF-kappa-B-activating protein 413, is a member of the Nedd4 family. NDFIP2 activates the HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2. NDFIP2 also recruits ITCH, NEDD4, and SMURF2 to endosomal membranes. NDFIP2 may also play a role in modulating EGFR signaling and other cellular processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDFIP2