NCOA4 Antibody (2H8)

Images

 
Immunocytochemistry/ Immunofluorescence: NCOA4 Antibody (2H8) [H00008031-M01] - Analysis of monoclonal antibody to NCOA4 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NCOA4 Antibody (2H8) Summary

Immunogen
NCOA4 (AAH12736.1, 1 a.a. - 575 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDENCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPSRIADSFQVIKNSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKYYLIHLYRRNITSPQTIMASLQFVISLPVCSLKLIKRSGYIELLYRCEGMDKS
Specificity
NCOA4 - nuclear receptor coactivator 4
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NCOA4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NCOA4 Antibody (2H8)

  • Androgen receptor coactivator 70 kDa protein
  • Androgen receptor-associated protein of 70 kDa
  • ARA70RFGret fused
  • DKFZp762E1112
  • ELE1NCoA-4
  • nuclear receptor coactivator 4,70 kDa AR-activator
  • PTC3RET-activating gene ELE1
  • Ret-activating protein ELE1,70 kDa androgen receptor coactivator

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF482
Species: Mu
Applications: WB, IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
AF5626
Species: Hu
Applications: WB, ICC
NBP1-89021
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4078
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
H00008031-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for NCOA4 Antibody (H00008031-M01) (0)

There are no publications for NCOA4 Antibody (H00008031-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCOA4 Antibody (H00008031-M01) (0)

There are no reviews for NCOA4 Antibody (H00008031-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NCOA4 Antibody (H00008031-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NCOA4 Products

Bioinformatics Tool for NCOA4 Antibody (H00008031-M01)

Discover related pathways, diseases and genes to NCOA4 Antibody (H00008031-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCOA4 Antibody (H00008031-M01)

Discover more about diseases related to NCOA4 Antibody (H00008031-M01).
 

Pathways for NCOA4 Antibody (H00008031-M01)

View related products by pathway.

PTMs for NCOA4 Antibody (H00008031-M01)

Learn more about PTMs related to NCOA4 Antibody (H00008031-M01).

Blogs on NCOA4

There are no specific blogs for NCOA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NCOA4 Antibody (2H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol NCOA4
Entrez
OMIM
Uniprot