NCF1 Recombinant Protein Antigen

Images

 
There are currently no images for NCF1 Protein (NBP2-33638PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NCF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCF1.

Source: E. coli

Amino Acid Sequence: SGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NCF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33638.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NCF1 Recombinant Protein Antigen

  • 47 kDa neutrophil oxidase factor
  • FLJ79451
  • NADPH oxidase organizer 2
  • NCF-1
  • NCF1A
  • neutrophil cytosol factor 1,47 kDa autosomal chronic granulomatous disease protein
  • neutrophil cytosolic factor 1 (47kD, chronic granulomatous disease, autosomal1)
  • neutrophil cytosolic factor 1
  • neutrophil cytosolic factor 1, (chronic granulomatous disease, autosomal 1)
  • Neutrophil NADPH oxidase factor 1
  • Nox organizer 2
  • NOXO2NCF-47K
  • Nox-organizing protein 2
  • p47phox
  • SH3 and PX domain-containing protein 1A
  • SH3PXD1Ap47-phox

Background

NCF1, along with NCF2 and a membrane bound cytochrome b558, is required for activation of the latent NADPH oxidase necessary for superoxide production. Defects in NCF1 are the cause of autosomal cytochrome-b-positive chronic granulomatous disease type 1 (CGD). NCF1 is a cytosolic subunit of the multi-protein complex known as NADPH oxidase found in neutrophils.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41291
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-82542
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-13677
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1904
Species: Hu
Applications: ICC, IHC, WB
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF5758
Species: Hu
Applications: ICC, IHC, WB
NBP3-03403
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-61666
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-05513
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-22377
Species: Hu
Applications: IHC,  IHC-P, WB
AF5675
Species: Hu, Mu, Rt
Applications: IHC, IP, KO, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP2-33638PEP
Species: Hu
Applications: AC

Publications for NCF1 Protein (NBP2-33638PEP) (0)

There are no publications for NCF1 Protein (NBP2-33638PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCF1 Protein (NBP2-33638PEP) (0)

There are no reviews for NCF1 Protein (NBP2-33638PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NCF1 Protein (NBP2-33638PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCF1 Products

Research Areas for NCF1 Protein (NBP2-33638PEP)

Find related products by research area.

Blogs on NCF1.

Identifying tumoral and stromal transcriptomes that underlie tumor plasticity and stromal neuroinflammatory response in brain metastasis
By Jamshed Arslan, Pharm. D., PhD. Cancers in the brain often come from tumors elsewhere in the body. Several adaptive mechanisms influence brain metastasis, such as blood brain barrier leakage that can be induced by ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NCF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NCF1