Recombinant Human NCAPH Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NCAPH Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 645-741 of Human BRRN1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KKLKQSMWSLLTALSGKEADAEANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQGD

Protein/Peptide Type
Partial Recombinant Protein
Gene
NCAPH

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NCAPH Protein

  • barren (Drosophila) homolog
  • barren homolog (Drosophila)
  • barren homolog 1 (Drosophila)
  • barren homolog 1
  • Barren homolog protein 1
  • BRRN
  • BRRN1CAP-H
  • CAPH
  • Chromosome-associated protein H
  • condensin complex subunit 2
  • HCAP-H
  • KIAA0074
  • Non-SMC condensin I complex subunit H
  • non-SMC condensin I complex, subunit H
  • XCAP-H homolog

Background

BRRN1 - barren homolog (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-373
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-88202
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86635
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-207
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-49973
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-49620
Species: Hu
Applications: WB, IA, ICC/IF, IHC, IHC-P
NB100-1573
Species: Hu
Applications: WB, IP
NBP2-57371
Species: Hu
Applications: ICC/IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56487
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP
H00064151-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91348
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12904
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
NB100-87021
Species: Hu
Applications: WB, IP, PLA
H00023397-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for NCAPH Partial Recombinant Protein (H00023397-Q01) (0)

There are no publications for NCAPH Partial Recombinant Protein (H00023397-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCAPH Partial Recombinant Protein (H00023397-Q01) (0)

There are no reviews for NCAPH Partial Recombinant Protein (H00023397-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NCAPH Partial Recombinant Protein (H00023397-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCAPH Products

Bioinformatics Tool for NCAPH Partial Recombinant Protein (H00023397-Q01)

Discover related pathways, diseases and genes to NCAPH Partial Recombinant Protein (H00023397-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCAPH Partial Recombinant Protein (H00023397-Q01)

Discover more about diseases related to NCAPH Partial Recombinant Protein (H00023397-Q01).
 

Pathways for NCAPH Partial Recombinant Protein (H00023397-Q01)

View related products by pathway.

PTMs for NCAPH Partial Recombinant Protein (H00023397-Q01)

Learn more about PTMs related to NCAPH Partial Recombinant Protein (H00023397-Q01).
 

Research Areas for NCAPH Partial Recombinant Protein (H00023397-Q01)

Find related products by research area.

Blogs on NCAPH

There are no specific blogs for NCAPH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NCAPH Antibody
NBP1-32573

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NCAPH Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NCAPH