NBR1 Antibody

Western Blot: NBR1 Antibody [H00004077-B01P] - Analysis of NBR1 expression in transfected 293T cell line by NBR1 polyclonal antibody. Lane 1: NBR1 transfected lysate(106.26 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

NBR1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: NBR1 (NP_005890.2, 1 a.a. - 966 a.a.) full-length human protein. MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCTSVMPMLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSEESPDNIEKGMISSSKTDDLTCQQEETFLLAKEERQLGEVTEQTEGTAACIPQKAKNVASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDVTPCMSPLPHDSPLIEKPGLGQIEEENEGAGFKALPDSMVSVKRKAENIASVEEAEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQKSLQMTFALPEGPLGNEKEEIIHIAEEEAVMEEEEDEEDEEEEDELKDEVQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGKPGVEAGQEPAEAGERLPGGENQPQEHSISDILTTSQTLETVPLIPEVVELPPSLPRSSPCVHHHGSPGVDLPVTIPEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRHHHGSSIAGGLVKGALSVAASAYKALFAGPPVTAQPIISEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNNDWYSQRY
• Specificity: NBR1 - neighbor of BRCA1 gene 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: NBR1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunoprecipitation
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NBR1 Antibody

• Cell migration-inducing gene 19 protein
• FLJ98272
• KIAA0049CA125
• M17S2FLJ55359,1A1-3B
• Membrane component chromosome 17 surface marker 2,1A13B
• membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigenCA125)
• migration-inducing protein 19
• Neighbor of BRCA1 gene 1 protein
• neighbor of BRCA1 gene 1
• next to BRCA1 gene 1 protein
• Protein 1A1-3B

Background

The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NBR1 Antibody (H00004077-B01P)(3)

Publications using H00004077-B01P

• Ma X, Lu C, Chen Y et al. CCT2 is an aggrephagy receptor for clearance of solid protein aggregates Cell 2022-03-27 [PMID: 35366418] (WB, Human)
• Barnett TC, Liebl D, Seymour LM et al. The Globally Disseminated M1T1 Clone of Group A Streptococcus Evades Autophagy for Intracellular Replication. Cell Host Microbe. 2013-12-11 [PMID: 24331465]
• Kuo TC, Chen CT, Baron D et al. Midbody accumulation through evasion of autophagy contributes to cellular reprogramming and tumorigenicity. Nat Cell Biol 2011-09-11 [PMID: 21909099]

Review for NBR1 Antibody (H00004077-B01P) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 08/17/2009

Summary

• Application: Western Blot
• Sample Tested: Human HeLa cells, Sample Amount: 20 ug
• Species: Human
• Lot: 08270WULz

Bioinformatics

• Gene Symbol: NBR1
• Entrez:
  • 4077(Human)
• Uniprot:
  • NP_005890.2(Human)