NAV3 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NAV3. Source: E.coli
Amino Acid Sequence: STDDLNTTSSVSSYSNITVPSRKNTQLRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGKWKTVSSGLPEDPEKAGQKASLS |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
NAV3 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This peptide is useful as a blocking peptide for NBP1-82951.Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.For further blocking peptide related information and a protocol, click here. |
Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Alternate Names for NAV3 Recombinant Protein Antigen
Background
The NAV3 gene belongs to the neuron navigator family and is expressed predominantly in the nervous system. The encodedprotein contains coiled-coil domains and a conserved AAA domain characteristic for ATPases associated with a varietyof cellular activities. T
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ce, Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu
Applications: Flow-CS, Flow, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Publications for NAV3 Protein (NBP1-82951PEP) (0)
There are no publications for NAV3 Protein (NBP1-82951PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NAV3 Protein (NBP1-82951PEP) (0)
There are no reviews for NAV3 Protein (NBP1-82951PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for NAV3 Protein (NBP1-82951PEP) (0)
Additional NAV3 Products
Bioinformatics Tool for NAV3 Protein (NBP1-82951PEP)
Discover related pathways, diseases and genes to NAV3 Protein (NBP1-82951PEP). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for NAV3 Protein (NBP1-82951PEP)
Discover more about diseases related to NAV3 Protein (NBP1-82951PEP).
| | Pathways for NAV3 Protein (NBP1-82951PEP)
View related products by pathway.
|
Research Areas for NAV3 Protein (NBP1-82951PEP)
Find related products by research area.
|
Blogs on NAV3