NAV2 Antibody (4D11) - Azide and BSA Free

Sandwich ELISA: NAV2 Antibody (4D11) [H00089797-M01] - Detection limit for recombinant GST tagged NAV2 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4D11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NAV2 Antibody (4D11) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse NAV2 Antibody (4D11) - Azide and BSA Free (H00089797-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: NAV2 (NP_892009.2, 1878 a.a. ~ 1973 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVS
• Specificity: NAV2 - neuron navigator 2 (4D11)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NAV2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NAV2 Antibody (4D11) - Azide and BSA Free

• EC 3.6.4.12
• FLJ10633
• FLJ11030
• FLJ23707
• HELAD1UNC53H2
• Helicase APC down-regulated 1
• KIAA1419STEERIN2
• neuron navigator 2
• POMFIL2helicase, APC down-regulated 1
• pore membrane and/or filament interacting like protein 2
• Pore membrane and/or filament-interacting-like protein 2
• RAINB1FLJ77876
• retinoic acid inducible gene in neuroblastoma 1
• Retinoic acid inducible in neuroblastoma 1
• steerin-2
• Unc-53 homolog 2
• unc53H2

Background

The vitamin A metabolite, all-trans retinoic acid (atRA), plays an important role in neuronal development, including neurite outgrowth. RAINB1 is an atRA-responsive gene.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAV2
• Entrez:
  • 89797(Human)
• Uniprot:
  • NP_892009(Human)