NAT9 Antibody

Images

 
Western Blot: NAT9 Antibody [NBP1-53194] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAT9 Antibody Summary

Immunogen
Synthetic peptides corresponding to NAT9(N-acetyltransferase 9 (GCN5-related, putative)) Antibody(against the N terminal of NAT9. Peptide sequence MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (93%), Canine (93%), Equine (93%), Rabbit (93%), Bovine (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAT9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against NAT9 and was validated on Western blot.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NAT9 Antibody

  • DKFZP564C103
  • EBS
  • EBSP, hNATL
  • EC 2.3.1.-
  • embryo brain specific protein
  • Embryo brain-specific protein
  • N-acetyltransferase 9 (GCN5-related, putative)
  • N-acetyltransferase 9

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66826
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NB110-56916
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-536
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16366
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001958-M03
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-70694
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-31113
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-89142
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84020
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NAT9 Antibody (NBP1-53194) (0)

There are no publications for NAT9 Antibody (NBP1-53194).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAT9 Antibody (NBP1-53194) (0)

There are no reviews for NAT9 Antibody (NBP1-53194). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NAT9 Antibody (NBP1-53194) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NAT9 Products

Bioinformatics Tool for NAT9 Antibody (NBP1-53194)

Discover related pathways, diseases and genes to NAT9 Antibody (NBP1-53194). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAT9 Antibody (NBP1-53194)

Discover more about diseases related to NAT9 Antibody (NBP1-53194).
 

Pathways for NAT9 Antibody (NBP1-53194)

View related products by pathway.

Blogs on NAT9

There are no specific blogs for NAT9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAT9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAT9
Uniprot