NAT1 Antibody [DyLight 650]

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 650

NAT1 Antibody [DyLight 650] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human NAT1 (NP_001153646.1).
  
  Sequence:
  MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for NAT1 Antibody [DyLight 650]

• AAC1N-acetyltransferase type 1
• Arylamide acetylase 1
• arylamine N-acetyltransferase 1
• EC 2.3.1.5
• MNAT
• Monomorphic arylamine N-acetyltransferase
• N-acetyltransferase 1 (arylamine N-acetyltransferase)
• NAT-1
• NATI

Background

NAT1 is a gene that codes for a protein that helps in the detoxification of various hydrazine and arylamine drugs as well as to bioactivate several carcinogens and is 290 amino acids long with a weight of approximately 34 kDa. Current studies are being done on several diseases and disorders related to this gene including neural tube defect, drug-induced hepatitis, talipes equinovarus, spina bifida, multiple chemical sensitivity, malignant pleural mesothelioma, non-Hodgkin lymphoma, cleft palate, familial adenomatous polyposis, substance abuse, orofacial cleft, peptic ulcer, lymphoblastic leukemia, systemic lupus erythematosus, cystic fibrosis, lupus erythematosus, Hodgkin's lymphoma, inflammatory bowel disease, and motor neuron disease. NAT1 has also been shown to have interactions with NAA10, SNTA1, SYP1A2, CYP2A6, and XDH in pathways such as the arylamine metabolism, acetylation, and drug metabolism pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAT1