NAT1 Antibody [DyLight 488] Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human NAT1 (NP_001153646.1).
Sequence: MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NAT1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.
Alternate Names for NAT1 Antibody [DyLight 488]
Background
NAT1 is a gene that codes for a protein that helps in the detoxification of various hydrazine and arylamine drugs as well as to bioactivate several carcinogens and is 290 amino acids long with a weight of approximately 34 kDa. Current studies are being done on several diseases and disorders related to this gene including neural tube defect, drug-induced hepatitis, talipes equinovarus, spina bifida, multiple chemical sensitivity, malignant pleural mesothelioma, non-Hodgkin lymphoma, cleft palate, familial adenomatous polyposis, substance abuse, orofacial cleft, peptic ulcer, lymphoblastic leukemia, systemic lupus erythematosus, cystic fibrosis, lupus erythematosus, Hodgkin's lymphoma, inflammatory bowel disease, and motor neuron disease. NAT1 has also been shown to have interactions with NAA10, SNTA1, SYP1A2, CYP2A6, and XDH in pathways such as the arylamine metabolism, acetylation, and drug metabolism pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Publications for NAT1 Antibody (NBP3-35579G) (0)
There are no publications for NAT1 Antibody (NBP3-35579G).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NAT1 Antibody (NBP3-35579G) (0)
There are no reviews for NAT1 Antibody (NBP3-35579G).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NAT1 Antibody (NBP3-35579G) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NAT1 Products
Blogs on NAT1