NARS Antibody (2D6)

Images

 
Western Blot: NARS Antibody (2D6) [H00004677-M01] - NARS monoclonal antibody (M01), clone 2D6 Analysis of NARS expression in K-562.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2D6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NARS Antibody (2D6) Summary

Immunogen
NARS (AAH01687, 1 a.a. - 548 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP
Specificity
NARS - asparaginyl-tRNA synthetase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NARS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NARS Antibody (2D6)

  • ASNRS
  • asparagine tRNA ligase 1, cytoplasmic
  • Asparagine--tRNA ligase
  • asparaginyl-tRNA synthetase
  • asparaginyl-tRNA synthetase, cytoplasmic
  • EC 6.1.1.22
  • NARS1

Background

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Asparaginyl-tRNA synthetase is localized to the cytoplasm and belongs to the class II family of tRNA synthetases. The N-terminal domain represents the signature sequence for the eukaryotic asparaginyl-tRNA synthetases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83854
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57136
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-55125
Species: Hu
Applications: WB, ICC/IF
NBP2-55125
Species: Hu
Applications: WB, ICC/IF
NBP1-86624
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87706
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38035
Species: Hu
Applications: IHC, IHC-P
NBP2-01425
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-20567
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-92106
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33413
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NARS Antibody (H00004677-M01) (0)

There are no publications for NARS Antibody (H00004677-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NARS Antibody (H00004677-M01) (0)

There are no reviews for NARS Antibody (H00004677-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NARS Antibody (H00004677-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NARS Products

Bioinformatics Tool for NARS Antibody (H00004677-M01)

Discover related pathways, diseases and genes to NARS Antibody (H00004677-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NARS Antibody (H00004677-M01)

Discover more about diseases related to NARS Antibody (H00004677-M01).
 

Pathways for NARS Antibody (H00004677-M01)

View related products by pathway.

PTMs for NARS Antibody (H00004677-M01)

Learn more about PTMs related to NARS Antibody (H00004677-M01).

Blogs on NARS

There are no specific blogs for NARS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NARS Antibody (2D6) and receive a gift card or discount.

Bioinformatics

Gene Symbol NARS
Entrez
OMIM
Uniprot