NAPG Antibody (4B5)

Images

 
Western Blot: NAPG Antibody (4B5) [H00008774-M03] - Analysis of NAPG expression in HepG2 (Cat # L019V1).
Sandwich ELISA: NAPG Antibody (4B5) [H00008774-M03] - Detection limit for recombinant GST tagged NAPG is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NAPG Antibody (4B5) Summary

Immunogen
NAPG (NP_003817.1, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEK
Specificity
Reacts with N-ethylmaleimide-sensitive factor attachment protein, gamma.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NAPG
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate in WB and recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NAPG Antibody (4B5)

  • gamma SNAP
  • GAMMASNAP
  • gamma-soluble NSF attachment protein
  • N-ethylmaleimide-sensitive factor attachment protein gamma
  • N-ethylmaleimide-sensitive factor attachment protein, gamma
  • SNAPG
  • SNAP-gamma
  • soluble NSF attachment protein

Background

This gene encodes soluble NSF attachment protein gamma. The soluble NSF attachment proteins (SNAPs) enable N-ethyl-maleimide-sensitive fusion protein (NSF) to bind to target membranes. NSF and SNAPs appear to be general components of the intracellular membrane fusion apparatus, and their action at specific sites of fusion must be controlled by SNAP receptors particular to the membranes being fused. The product of this gene mediates platelet exocytosis and controls the membrane fusion events of this process.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP1-32493
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-87374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
AF4828
Species: Hu, Mu
Applications: WB, IHC
AF5354
Species: Hu
Applications: WB, IHC
MAB2568
Species: Mu
Applications: WB, IHC
NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NAPG Antibody (H00008774-M03) (0)

There are no publications for NAPG Antibody (H00008774-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAPG Antibody (H00008774-M03) (0)

There are no reviews for NAPG Antibody (H00008774-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NAPG Antibody (H00008774-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAPG Products

Bioinformatics Tool for NAPG Antibody (H00008774-M03)

Discover related pathways, diseases and genes to NAPG Antibody (H00008774-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAPG Antibody (H00008774-M03)

Discover more about diseases related to NAPG Antibody (H00008774-M03).
 

Pathways for NAPG Antibody (H00008774-M03)

View related products by pathway.

PTMs for NAPG Antibody (H00008774-M03)

Learn more about PTMs related to NAPG Antibody (H00008774-M03).

Blogs on NAPG

There are no specific blogs for NAPG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAPG Antibody (4B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol NAPG
Entrez
Uniprot