NACA2 Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

NACA2 Partial Recombinant Protein Summary

Description
NACA2 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: ASDAYIVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV
Preparation
Method
in vitro wheat germ expression system
Gene
NACA2

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NACA2 Partial Recombinant Protein

  • alpha-NAC protein
  • Alpha-NAC-like
  • ANAC
  • hom s 2.01 protein
  • Hom s 2.01
  • IgE autoantigen alpha-nascent polypeptide-associated complex
  • MGC71999
  • NACAL
  • NAC-alpha-like
  • nascent polypeptide-associated complex alpha subunit 2
  • nascent polypeptide-associated complex subunit alpha-2
  • Nascent polypeptide-associated complex subunit alpha-like
  • nascent polypeptide-associated complex, alpha polypeptide, 2
  • nascent-polypeptide-associated complex alpha polypeptide-like

Background

NACAL - alpha-NAC protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004666-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-54899
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr
NB300-127
Species: Mu, Rt, Ca, Ch, Rb
Applications: WB, ICC/IF
MAB8930
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-32879
Species: Hu
Applications: WB
NB110-75039
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF2485
Species: Hu
Applications: WB, IHC, IP
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-86892
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NBP2-33688
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
AF2307
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB600-232
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP

Publications for NACA2 Partial Recombinant Protein (H00342538-Q01) (0)

There are no publications for NACA2 Partial Recombinant Protein (H00342538-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NACA2 Partial Recombinant Protein (H00342538-Q01) (0)

There are no reviews for NACA2 Partial Recombinant Protein (H00342538-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NACA2 Partial Recombinant Protein (H00342538-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NACA2 Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for NACA2 Partial Recombinant Protein (H00342538-Q01)

Discover related pathways, diseases and genes to NACA2 Partial Recombinant Protein (H00342538-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NACA2 Partial Recombinant Protein (H00342538-Q01)

Discover more about diseases related to NACA2 Partial Recombinant Protein (H00342538-Q01).

Blogs on NACA2

There are no specific blogs for NACA2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol NACA2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00342538-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

NACA2 Recombinant Protein
H00342538-P01-10ug
NACA2 Antibody
H00342538-B01P
NACA2 Antibody
H00342538-B01P