N-Acetylmannosamine Kinase/GNE Recombinant Protein Antigen

Images

 
There are currently no images for N-Acetylmannosamine Kinase/GNE Protein (NBP1-81621PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

N-Acetylmannosamine Kinase/GNE Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GNE.

Source: E. coli

Amino Acid Sequence: VPFDQFIQLVAHAGCMIGNSSCGVREVGAFGTPVINLGTRQIGRETGENVLHVRDADTQDKILQALHLQFGKQYPCSKIYGDGNAVPRILKFLKSIDLQEPLQKKFCFPPVKENISQDIDHILETLSALAVDLGGTNLRVA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GNE
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81621.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for N-Acetylmannosamine Kinase/GNE Recombinant Protein Antigen

  • bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
  • DMRV
  • GLCNE
  • GLCNENM
  • glucosamine (UDP-N-acetyl)-2-epimerase/N-acetylmannosamine kinase
  • GNE
  • IBM2
  • NAcetylmannosamine Kinase
  • N-Acetylmannosamine Kinase
  • N-acylmannosamine kinase
  • Uae1
  • UDP-GlcNAc-2-epimerase/ManAc kinase
  • UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
  • UDP-N-acetylglucosamine-2-epimerase/N-acetylmannosamine kinase

Background

The protein encoded by the GNE gene is a bifunctional enzyme that monitors and begins biosynthesis of N-acetylneuraminic acid (NeuAc). NeuAC is a precursor of sialic acids and functions in early development as sialylation is a component of cell adhesion, signal transduction, and tumorigencity and metastic behavior of malignant cells. The GNE gene has been linked to various diseases such as: myopathy, dementia, glomerulosclerosis, muscular dystrophy, and neuromuscular disease. This protein creates an enzyme that is rate-limiting in the sialic acid biosynthetic pathway as well as plays a role in amino and nucleotide sugar metabolism as well as CMP-N-acetylneuraminate biosynthesis in eukaryotes. The GNE gene is known to interact with genes CRMP1. ZBTB16, PIK3C2A, KIAA1549, and RIF1 to participate in these pathways. GNE exists is five isoforms: isoform 1: 722 amino acids long; 79 kDA; isoform 2: 753 amino acids long, 83 kDA; isoform 3: 681 amino acids long; 74 kDA; isoform 4: 648 amino acids long, 71 kDA; isoform 5: 612 amino acids long, 66 kDA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59376
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
NBP1-80851
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-20492
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-89750
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84696
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00055907-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
AF6868
Species: Hu
Applications: IHC, KO, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MEP00B
Species: Mu
Applications: ELISA
NBP1-87066
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-89953
Species: Hu, Mu
Applications: IHC,  IHC-P
AF3844
Species: Hu, Mu
Applications: IHC
NBP1-88522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00011155-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, KD, WB
NBP1-81621PEP
Species: Hu
Applications: AC

Publications for N-Acetylmannosamine Kinase/GNE Protein (NBP1-81621PEP) (0)

There are no publications for N-Acetylmannosamine Kinase/GNE Protein (NBP1-81621PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for N-Acetylmannosamine Kinase/GNE Protein (NBP1-81621PEP) (0)

There are no reviews for N-Acetylmannosamine Kinase/GNE Protein (NBP1-81621PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for N-Acetylmannosamine Kinase/GNE Protein (NBP1-81621PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional N-Acetylmannosamine Kinase/GNE Products

Research Areas for N-Acetylmannosamine Kinase/GNE Protein (NBP1-81621PEP)

Find related products by research area.

Blogs on N-Acetylmannosamine Kinase/GNE

There are no specific blogs for N-Acetylmannosamine Kinase/GNE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our N-Acetylmannosamine Kinase/GNE Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GNE