Recombinant Human MZF1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MZF1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 419-518 of Human ZNF42 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: QGFVRSARLEEHRRVHTGEQPFRCAECGQSFRQRSNLLQHQRIHGDPPGPGAKPPAPPGAPEPPGPFPCSECRESFARRAVLLEHQAVHTGDKSFGCVEC

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MZF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MZF1 GST (N-Term) Protein

  • myeloid zinc finger 1
  • MZF1B
  • MZF-1zinc finger protein 42 (myeloid-specific retinoic acid-responsive)
  • Zfp98
  • Zinc finger protein 42
  • ZNF42MZF
  • ZSCAN6Zinc finger and SCAN domain-containing protein 6

Background

ZNF42 - zinc finger protein 42 (myeloid-specific retinoic acid-responsive)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
DPSG10
Species: Hu
Applications: ELISA
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-67710
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF4256
Species: Hu
Applications: WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-56092
Species: Hu
Applications: ICC/IF, WB
NBP2-67459
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
H00007593-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for MZF1 Partial Recombinant Protein (H00007593-Q01) (0)

There are no publications for MZF1 Partial Recombinant Protein (H00007593-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MZF1 Partial Recombinant Protein (H00007593-Q01) (0)

There are no reviews for MZF1 Partial Recombinant Protein (H00007593-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MZF1 Partial Recombinant Protein (H00007593-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MZF1 Products

Bioinformatics Tool for MZF1 Partial Recombinant Protein (H00007593-Q01)

Discover related pathways, diseases and genes to MZF1 Partial Recombinant Protein (H00007593-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MZF1 Partial Recombinant Protein (H00007593-Q01)

Discover more about diseases related to MZF1 Partial Recombinant Protein (H00007593-Q01).
 

Pathways for MZF1 Partial Recombinant Protein (H00007593-Q01)

View related products by pathway.

PTMs for MZF1 Partial Recombinant Protein (H00007593-Q01)

Learn more about PTMs related to MZF1 Partial Recombinant Protein (H00007593-Q01).

Blogs on MZF1

There are no specific blogs for MZF1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MZF1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MZF1