Recombinant Human MYT1L Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MYT1L Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 301-410 of Human MYT1L partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLGKPMNNGLMEKMVEESDEEVCLSSLECLRNQCFDLARKLSETNPQERNPQQNMNIRQHVRPEEDFPGRTPDRNYSDMLNLMRLEEQLSPRSRVFASCAKEDGCHERDD

Protein/Peptide Type
Partial Recombinant Protein
Gene
MYT1L

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MYT1L Protein

  • KIAA1106neural zinc finger transcription factor 1
  • myelin transcription factor 1-like protein
  • myelin transcription factor 1-like
  • MyT1L
  • MyT1-L
  • NZF1

Background

MYT1L - myelin transcription factor 1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81021
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-02275
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-61436
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
AF2567
Species: Mu
Applications: WB, IHC
AF3086
Species: Hu
Applications: WB, IHC
AF3444
Species: Hu
Applications: WB
NBP2-07463
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83792
Species: Hu
Applications: IHC, IHC-P
NBP1-92445
Species: Hu
Applications: IHC, IHC-P
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
AF4377
Species: Hu, Mu
Applications: WB, ICC
H00001501-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-20367
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for MYT1L Partial Recombinant Protein (H00023040-Q01) (0)

There are no publications for MYT1L Partial Recombinant Protein (H00023040-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYT1L Partial Recombinant Protein (H00023040-Q01) (0)

There are no reviews for MYT1L Partial Recombinant Protein (H00023040-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYT1L Partial Recombinant Protein (H00023040-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MYT1L Products

MYT1L H00023040-Q01

Bioinformatics Tool for MYT1L Partial Recombinant Protein (H00023040-Q01)

Discover related pathways, diseases and genes to MYT1L Partial Recombinant Protein (H00023040-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYT1L Partial Recombinant Protein (H00023040-Q01)

Discover more about diseases related to MYT1L Partial Recombinant Protein (H00023040-Q01).
 

Pathways for MYT1L Partial Recombinant Protein (H00023040-Q01)

View related products by pathway.

Blogs on MYT1L

There are no specific blogs for MYT1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MAP2 Antibody
NB300-213
HDAC1 Antibody
NB100-56340
Glut2 Antibody
NBP2-22218

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MYT1L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MYT1L