Myosin Phosphatase 2 Antibody - Azide and BSA Free

Western Blot: Myosin Phosphatase 2 Antibody [H00004660-D01P] - Analysis of PPP1R12B expression in human kidney.

Western Blot: Myosin Phosphatase 2 Antibody [H00004660-D01P] - Analysis of PPP1R12B expression in transfected 293T cell line by PPP1R12B polyclonal antibody.Lane 1: PPP1R12B transfected lysate(43.30 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Myosin Phosphatase 2 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: PPP1R12B (ENSP00000349206, 1 a.a. - 386 a.a.) full-length human protein. MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSSSSEEEEGEDEASESETEKEAVLFWPF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP1R12B
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: It has been used for WB and Functional.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Myosin Phosphatase 2 Antibody - Azide and BSA Free

• MGC131980
• MGC87886
• Myosin phosphatase target subunit 2
• myosin phosphatase, target subunit 2
• Myosin phosphatase-targeting subunit 2
• MYPT 2
• MYPT2FLJ40942
• protein phosphatase 1 regulatory subunit 12B
• protein phosphatase 1, regulatory (inhibitor) subunit 12B

Background

PPP1R12B, also known as Protein phosphatase 1 regulatory subunit 12B, has 5 isoforms, a 982 amino acid isoform that is 110 kDa, a 386 amino acid isoform that is 43 kDa, a 224 amino acid isoform that is 26 kDa, a 208 amino acid isoform that is 24 kDa, and a 515 amino acid isoform that is 58 kDa; detected in skeletal muscle, fetal and adult heart, brain, placenta, kidney, spleen, thymus, pancreas and lung; with cytoplasmatic subcellular location; regulates myosin phosphatase activity and augments Ca(2+) sensitivity of the contractile apparatus. This protein is being studied for its involvement in breast cancer. The PPP1R12B protein has been shown to involve IL16, PPP1CB, PRKG1, HSPA8, MYL6, and MYL6B in RhoA pathway, PKA signaling, actin-based motility by Rho family GTPases, eIF2 pathway, CDK5 pathway, insulin pathway, G2/M transition, cell cycle, mitotic G2-G2/M phases, regulation of PLK1 activity at G2/M transition, cell cycle, mitotic, and vascular smooth muscle contraction pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP1R12B
• Uniprot:
  • ENSP00000349206(Human)