Recombinant Human Myosin IF Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Myosin IF Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 811-912 of Human Myosin IF

Source: Wheat Germ

Amino Acid Sequence: KKKVDIQALRGVSLSTRQDDFFILQEDAADSFLESVFKTEFVSLLCKRFEEATRRPLPLTFSDTLQFRVKKEGWGGGGTRSVTFSRGFGDLAVLKVGGRTLT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MYO1F
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.96 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Myosin IF Protein

  • myosin IF
  • myosin-ID
  • myosin-Ie
  • myosin-If

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92158
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87745
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30661
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87739
Species: Hu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93704
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
H00002035-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-85548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66897
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-66296
Species: Hu
NBP2-67584
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF1730
Species: Hu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
AF3827
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-98474
Species: Hu
Applications: WB
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NB600-231
Species: Hu
Applications: WB, IHC, IHC-P, KD

Publications for Myosin IF Partial Recombinant Protein (H00004542-Q01) (0)

There are no publications for Myosin IF Partial Recombinant Protein (H00004542-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin IF Partial Recombinant Protein (H00004542-Q01) (0)

There are no reviews for Myosin IF Partial Recombinant Protein (H00004542-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myosin IF Partial Recombinant Protein (H00004542-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Myosin IF Products

Myosin IF H00004542-Q01

Bioinformatics Tool for Myosin IF Partial Recombinant Protein (H00004542-Q01)

Discover related pathways, diseases and genes to Myosin IF Partial Recombinant Protein (H00004542-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin IF Partial Recombinant Protein (H00004542-Q01)

Discover more about diseases related to Myosin IF Partial Recombinant Protein (H00004542-Q01).
 

Pathways for Myosin IF Partial Recombinant Protein (H00004542-Q01)

View related products by pathway.

Blogs on Myosin IF

There are no specific blogs for Myosin IF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Myosin IF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO1F