Myosin heavy chain 11 Recombinant Protein Antigen

Images

 
There are currently no images for Myosin heavy chain 11 Recombinant Protein Antigen (NBP1-87025PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Myosin heavy chain 11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYH14.

Source: E. coli

Amino Acid Sequence: VTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYH11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87025.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Myosin heavy chain 11 Recombinant Protein Antigen

  • AAT4
  • FAA4
  • MYH11 myosin, heavy chain 11, smooth muscle
  • MYH11
  • SMHC
  • SMMHC
  • Smooth muscle myosin heavy chain

Background

The protein encoded by the MYH11 gene is a smooth muscle myosin belonging to the myosin heavy chain family. The gene product is a subunit of a hexameric protein that consists of two heavy chain subunits and two pairs of non-identical light chain subunits. MYH11 functions as a major contractile protein, converting chemical energy into mechanical energy through the hydrolysis of ATP. The gene encoding a human ortholog of rat NUDE1 is transcribed from the reverse strand of this gene, and its 3' end overlaps with that of the latter. The pericentric inversion of chromosome 16 [inv(16)(p13q22)] produces a chimeric transcript that encodes a protein consisting of the first 165 residues from the N terminus of core-binding factor beta in a fusion with the C-terminal portion of the smooth muscle myosin heavy chain. This chromosomal rearrangement is associated with acute myeloid leukemia of the M4Eo subtype. Alternative splicing generates isoforms that are differentially expressed, with ratios changing during muscle cell maturation. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92025
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-46466
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF7349
Species: Hu, Mu
Applications: ICC, WB
NBP2-55747
Species: Hu
Applications: ICC/IF, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NB100-59787
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB600-507
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, PEP-ELISA, WB
AF5129
Species: Hu
Applications: WB
NBP2-52406
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-47525
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-62489
Species: Dr, Hu, Mu
Applications: WB
NBP1-80695
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB812
Species: Hu
Applications: CyTOF-ready, Flow

Publications for Myosin heavy chain 11 Recombinant Protein Antigen (NBP1-87025PEP) (0)

There are no publications for Myosin heavy chain 11 Recombinant Protein Antigen (NBP1-87025PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin heavy chain 11 Recombinant Protein Antigen (NBP1-87025PEP) (0)

There are no reviews for Myosin heavy chain 11 Recombinant Protein Antigen (NBP1-87025PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Myosin heavy chain 11 Recombinant Protein Antigen (NBP1-87025PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Myosin heavy chain 11 Products

Research Areas for Myosin heavy chain 11 Recombinant Protein Antigen (NBP1-87025PEP)

Find related products by research area.

Blogs on Myosin heavy chain 11

There are no specific blogs for Myosin heavy chain 11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Myosin heavy chain 11 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MYH11