Recombinant Human Myosin 5a GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Func, PA, AP

Order Details

Recombinant Human Myosin 5a GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1758-1853 of Human Myosin 5a

Source: Wheat Germ (in vitro)

Amino Acid Sequence: KKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLRDRKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFIS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MYO5A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00004644-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Myosin 5a GST (N-Term) Protein

  • Dilute myosin heavy chain, non-muscle
  • GS1myosin, heavy polypeptide kinase
  • MYH12myosin-12
  • MYO5
  • Myosin heavy chain 12
  • myosin V
  • myosin VA (heavy chain 12, myoxin)
  • myosin VA (heavy polypeptide 12, myoxin)
  • Myosin-12
  • myosin-Va
  • myoxin
  • MYR12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
H00005873-M02
Species: Hu, Mu, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
NBP2-45883
Species: Hu
Applications: WB, IHC
NBP2-19878
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB4470
Species: All-Multi
Applications: WB, IHC, ICC
NBP2-94213
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-1278
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-67796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB300-996
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB120-3481
Species: Hu, Mu, Rt, Bv, Ca, Gp, Pm
Applications: WB, IHC
NBP1-87746
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
AF1444
Species: Mu
Applications: WB, IHC
MAB39102
Species: Hu
Applications: ICC

Publications for Myosin 5a Partial Recombinant Protein (H00004644-Q01)(1)

Reviews for Myosin 5a Partial Recombinant Protein (H00004644-Q01) (0)

There are no reviews for Myosin 5a Partial Recombinant Protein (H00004644-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myosin 5a Partial Recombinant Protein (H00004644-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Myosin 5a Products

Bioinformatics Tool for Myosin 5a Partial Recombinant Protein (H00004644-Q01)

Discover related pathways, diseases and genes to Myosin 5a Partial Recombinant Protein (H00004644-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin 5a Partial Recombinant Protein (H00004644-Q01)

Discover more about diseases related to Myosin 5a Partial Recombinant Protein (H00004644-Q01).
 

Pathways for Myosin 5a Partial Recombinant Protein (H00004644-Q01)

View related products by pathway.

PTMs for Myosin 5a Partial Recombinant Protein (H00004644-Q01)

Learn more about PTMs related to Myosin 5a Partial Recombinant Protein (H00004644-Q01).

Blogs on Myosin 5a

There are no specific blogs for Myosin 5a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Myosin 5a GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO5A