We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human Myosin 1C GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related Myosin 1C Peptides and Proteins

Order Details


    • Catalog Number
      H00004641-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Myosin 1C GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 919-1028 of Human Myosin 1C

Source: Wheat Germ (in vitro)

Amino Acid Sequence: KVKQRIDYANLTGISVSSLSDSLFVLHVQRADNKQKGDVVLQSDHVIETLTKTALSANRVNSININQGSITFAGGPGRDGTIDFTPGSELLITKAKNGHLAVVAPRLNSR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MYO1C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Myosin 1C GST (N-Term) Protein

  • FLJ23903
  • MMIb
  • MMI-beta
  • Myosin I beta
  • myosin IC
  • myosin-I beta
  • myosin-Ic
  • myr2
  • NMI
  • nuclear myosin I

Background

This gene encodes a member of the unconventional myosin protein family, which are actin-based molecular motors. The protein is found in the cytoplasm, and one isoform with a unique N-terminus is also found in the nucleus. The nuclear isoform associates with RNA polymerase I and II and functions in transcription initiation. The mouse ortholog of this protein also functions in intracellular vesicle transport to the plasma membrane. Multiple transcript variants encoding different isoforms have been found for this gene. The related gene myosin IE has been referred to as myosin IC in the literature, but it is a distinct locus on chromosome 19. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP3-46969
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-87739
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-01108
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
NB100-2564
Species: Hu
Applications: WB
NBP2-59478
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-02300
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-87745
Species: Hu
Applications: IHC,  IHC-P, WB
NB600-279
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB200-109
Species: Hu, Mu
Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB100-56561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-21878
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
H00004646-M02
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB

Publications for Myosin 1C Partial Recombinant Protein (H00004641-Q01) (0)

There are no publications for Myosin 1C Partial Recombinant Protein (H00004641-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin 1C Partial Recombinant Protein (H00004641-Q01) (0)

There are no reviews for Myosin 1C Partial Recombinant Protein (H00004641-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myosin 1C Partial Recombinant Protein (H00004641-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Myosin 1C Products

Research Areas for Myosin 1C Partial Recombinant Protein (H00004641-Q01)

Find related products by research area.

Blogs on Myosin 1C.

Auditory Infographic: Can you hear me now?
The auditory process involves several structures of the ear to convert sound waves into information that is processed by our brain. Learn more about the auditory process in our infographic below. Novus Biologicals offers reagents mentioned in the inf...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Myosin 1C GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO1C