Myosin 1B Antibody - BSA Free

Western Blot: Myosin 1B Antibody [NBP2-38888] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line PC-3

Immunocytochemistry/Immunofluorescence: Myosin 1B Antibody [NBP2-38888] - Staining of human cell line U-2 OS shows localization to plasma membrane.

Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP2-38888] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP2-38888] - Staining of human liver shows moderate membranous positivity in hepatocytes and bile duct cells.

Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP2-38888] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP2-38888] - Staining of human liver shows moderate membranous positivity in hepatocytes.

Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP2-38888] - Staining of human lymph node shows strong membranous positivity in germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Myosin 1B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Myosin 1B Antibody - BSA Free (NBP2-38888) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EVVNKINRANGKSTSRIFLLTNNNLLLADQKSGQIKSEVPLVDVTKVSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFR
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYO1B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Myosin 1B Protein (NBP2-38888PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Myosin 1B Antibody - BSA Free

• MMIa
• MMI-alpha
• MYH-1c
• MYO1B variant protein
• Myosin I alpha
• myosin IB
• myosin-I alpha
• myosin-Ib
• myr1

Background

Myosin 1B is a motor protein which is involved in neuronal development, membrane trafficking/dynamics and functions including cell migration, vesicular transport and neurite outgrowth. Myosin 1B is known to have interactions with other proteins such as MAP3K3, RIPK3, BRF2, EIF4A2 and CIAO1. Myosin 1B has been studied in relation to neuronitis, amebiasis and dysentery.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYO1B
• Uniprot:
  • O43795(Human)