Myoglobin Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Myoglobin. Source: E. coli
Amino Acid Sequence: DGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MB |
| Purity |
>80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie® Blue stain |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54897. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie® Blue stain |
Alternate Names for Myoglobin Recombinant Protein Antigen
Background
Myoglobin is a small heme containing protein (153 amino acid residues, molecular weight (w/o heme) 17053 Da and theoretical pI=7.29) responsible for the oxygen deposition in muscle tissues. Only one form of myoglobin is expressed in cardiac and skeletal muscles. Myoglobin is known as a marker of myocardial damage and it has been used for more than three decades. Nowadays it still is very commonly used in clinical practice as an early marker of AMI. It appears in patient's blood 1 to 3 hours after onset of the symptoms, reaching peak level within 8 to 12 hours. Myoglobin is not so cardiac specific as cTnI or cTnT. Because of high myoglobin concentration in skeletal muscle tissue, even minor skeletal muscle injury results in the significant increase of myoglobin concentration in blood. Thus myoglobin is used together with cTnI or cTnT in clinical practise for better specificity in AMI diagnosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu
Applications: Flow, AP, IA, IHC, IHC-P, IP, S-ELISA, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu
Applications: Flow, IHC-P, WB
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Publications for Myoglobin Recombinant Protein Antigen (NBP2-54897PEP) (0)
There are no publications for Myoglobin Recombinant Protein Antigen (NBP2-54897PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Myoglobin Recombinant Protein Antigen (NBP2-54897PEP) (0)
There are no reviews for Myoglobin Recombinant Protein Antigen (NBP2-54897PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Myoglobin Recombinant Protein Antigen (NBP2-54897PEP) (0)
Additional Myoglobin Products
Research Areas for Myoglobin Recombinant Protein Antigen (NBP2-54897PEP)
Find related products by research area.
|
Blogs on Myoglobin