Myoglobin Recombinant Protein Antigen

Images

 
There are currently no images for Myoglobin Recombinant Protein Antigen (NBP2-54897PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Myoglobin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Myoglobin.

Source: E. coli

Amino Acid Sequence: DGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MB
Purity
>80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie® Blue stain

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54897.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie® Blue stain

Alternate Names for Myoglobin Recombinant Protein Antigen

  • MB
  • MGC13548
  • Myoglobin
  • PVALB

Background

Myoglobin is a small heme containing protein (153 amino acid residues, molecular weight (w/o heme) 17053 Da and theoretical pI=7.29) responsible for the oxygen deposition in muscle tissues. Only one form of myoglobin is expressed in cardiac and skeletal muscles. Myoglobin is known as a marker of myocardial damage and it has been used for more than three decades. Nowadays it still is very commonly used in clinical practice as an early marker of AMI. It appears in patient's blood 1 to 3 hours after onset of the symptoms, reaching peak level within 8 to 12 hours. Myoglobin is not so cardiac specific as cTnI or cTnT. Because of high myoglobin concentration in skeletal muscle tissue, even minor skeletal muscle injury results in the significant increase of myoglobin concentration in blood. Thus myoglobin is used together with cTnI or cTnT in clinical practise for better specificity in AMI diagnosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85630
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF3844
Species: Hu, Mu
Applications: IHC
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-35336
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
664-LI
Species: Hu
Applications: BA
NBP2-46395
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1106
Species: Hu
Applications: IP, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NB600-922
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
DY1707
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP2-54897PEP
Species: Hu
Applications: AC

Publications for Myoglobin Recombinant Protein Antigen (NBP2-54897PEP) (0)

There are no publications for Myoglobin Recombinant Protein Antigen (NBP2-54897PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myoglobin Recombinant Protein Antigen (NBP2-54897PEP) (0)

There are no reviews for Myoglobin Recombinant Protein Antigen (NBP2-54897PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Myoglobin Recombinant Protein Antigen (NBP2-54897PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Myoglobin Products

Research Areas for Myoglobin Recombinant Protein Antigen (NBP2-54897PEP)

Find related products by research area.

Blogs on Myoglobin

There are no specific blogs for Myoglobin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Myoglobin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MB