MYO16 Antibody

Images

 
Western Blot: MYO16 Antibody [NBP2-87865] - Host: Rabbit. Target Name: MYO16. Sample Type: COLO205 Whole cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Po, Bv, Ca, Eq, GpSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MYO16 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human MYO16. Peptide sequence: PPHLFSCVERAFHQLFREQRPQCFILSGERGSGKSEASKQIIRHLTCRAG The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Porcine (100%), Guinea Pig (93%), Equine (100%), Canine (100%), Bovine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
MYO16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MYO16 Antibody

  • KIAA0865
  • MYO16 variant protein
  • Myo16b
  • myosin XVI
  • myosin-XVI
  • MYR8
  • unconventional myosin-16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5514
Species: Hu, Mu
Applications: WB
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6347
Species: Hu
Applications: WB
NBP1-33116
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-67488
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34136
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP2-67504
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-94175
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93806
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB4470
Species: All-Multi
Applications: WB, IHC, ICC
NBP1-86624
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-87865
Species: Hu, Po, Bv, Ca, Eq, Gp
Applications: WB

Publications for MYO16 Antibody (NBP2-87865) (0)

There are no publications for MYO16 Antibody (NBP2-87865).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYO16 Antibody (NBP2-87865) (0)

There are no reviews for MYO16 Antibody (NBP2-87865). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYO16 Antibody (NBP2-87865) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MYO16 Products

Array NBP2-87865

Bioinformatics Tool for MYO16 Antibody (NBP2-87865)

Discover related pathways, diseases and genes to MYO16 Antibody (NBP2-87865). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYO16 Antibody (NBP2-87865)

Discover more about diseases related to MYO16 Antibody (NBP2-87865).

Blogs on MYO16

There are no specific blogs for MYO16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYO16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO16