MYH7 Recombinant Protein Antigen

Images

 
There are currently no images for MYH7 Recombinant Protein Antigen (NBP2-52737PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MYH7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYH7.

Source: E. coli

Amino Acid Sequence: ALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYH7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52737.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MYH7 Recombinant Protein Antigen

  • cardiac muscle beta isoform
  • CMD1S
  • CMD1SMGC138376
  • CMH1
  • DKFZp451F047
  • MGC138378
  • MPD1
  • MYH7
  • MYHCB
  • MyHC-beta
  • myhc-slow
  • myopathy, distal 1
  • myosin heavy chain (AA 1-96)
  • myosin, heavy chain 7, cardiac muscle, beta
  • myosin, heavy polypeptide 7, cardiac muscle, beta
  • Myosin-7
  • rhabdomyosarcoma antigen MU-RMS-40.7A
  • SPMD
  • SPMM

Background

MYH7, also known as Myosin-7, is a 1,935 amino acid protein that is 223 kDa, found predominantly in myocytes and mediates plus-ended movement along microfilaments, it is involved in muscle contraction through cyclic interactions with actin-rich thin filaments, creating a contractile force. It is regulated by phosphorylation via myosin light chain kinase (MLCK) and by intracellular Ca2+ concentrations. Disease research is currently being studied with relation to this protein and myopathy, hypertrophic cardiomyopathy, familial hypertrophic cardiomyopathy, dilated cardiomyopathy, wolff-parkinson-white syndrome, left ventricular noncompaction, left ventricular noncompaction 5, long qt syndrome, endocardial fibroelastosis, scapuloperoneal syndrome, laing distal myopathy, rhabdomyosarcoma oculopharyngeal muscular dystrophy, ebstein anomaly, acute myocardial infarction, muscular dystrophy, myotonic dystrophy, and myocardial infarction. Its involvement has been observed with relation to YWHAQ, MYH13, MYL3, YWHAZ, MYH9, ACTB, NTHL1, and over 100 other proteins in cell adhesion integrin-mediated cell adhesion and migration, cell adhesion tight junctions, cytoskeleton remodeling regulation of actin cytoskeleton by Rho GTPases, immune response CCR3 signaling in eosinophils, development MAG-dependent inhibition of neurite outgrowth, RhoA pathway, factors promoting cardiogenesis in vertebrates, antioxidant action of vitamin-C, transendothelial migration of leukocytes, actin nucleation by ARP-WASP complex, cardiac muscle contraction, hypertrophic cardiomyopathy (HCM), dilated cardiomyopathy, and viral myocarditis pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP2-13631
Species: Hu
Applications: IHC,  IHC-P, Single-Cell Western
MAB1874
Species: Hu
Applications: ICC, IHC
NBP3-16689
Species: Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-35336
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF3366
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-19807
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89090
Species: Hu
Applications: IHC,  IHC-P
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-30249
Species: Hu, Mu, Xp
Applications: ELISA, Flow, ICC/IF, IHC, WB
NBP1-97725
Species: Bv, Gt, Hu, Mu, Po, Rb, Rt, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-284
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB

Publications for MYH7 Recombinant Protein Antigen (NBP2-52737PEP) (0)

There are no publications for MYH7 Recombinant Protein Antigen (NBP2-52737PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYH7 Recombinant Protein Antigen (NBP2-52737PEP) (0)

There are no reviews for MYH7 Recombinant Protein Antigen (NBP2-52737PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MYH7 Recombinant Protein Antigen (NBP2-52737PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MYH7 Products

Research Areas for MYH7 Recombinant Protein Antigen (NBP2-52737PEP)

Find related products by research area.

Blogs on MYH7

There are no specific blogs for MYH7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MYH7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MYH7