MYH7 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYH7. Source: E. coli
Amino Acid Sequence: ALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MYH7 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52737. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for MYH7 Recombinant Protein Antigen
Background
MYH7, also known as Myosin-7, is a 1,935 amino acid protein that is 223 kDa, found predominantly in myocytes and mediates plus-ended movement along microfilaments, it is involved in muscle contraction through cyclic interactions with actin-rich thin filaments, creating a contractile force. It is regulated by phosphorylation via myosin light chain kinase (MLCK) and by intracellular Ca2+ concentrations. Disease research is currently being studied with relation to this protein and myopathy, hypertrophic cardiomyopathy, familial hypertrophic cardiomyopathy, dilated cardiomyopathy, wolff-parkinson-white syndrome, left ventricular noncompaction, left ventricular noncompaction 5, long qt syndrome, endocardial fibroelastosis, scapuloperoneal syndrome, laing distal myopathy, rhabdomyosarcoma oculopharyngeal muscular dystrophy, ebstein anomaly, acute myocardial infarction, muscular dystrophy, myotonic dystrophy, and myocardial infarction. Its involvement has been observed with relation to YWHAQ, MYH13, MYL3, YWHAZ, MYH9, ACTB, NTHL1, and over 100 other proteins in cell adhesion integrin-mediated cell adhesion and migration, cell adhesion tight junctions, cytoskeleton remodeling regulation of actin cytoskeleton by Rho GTPases, immune response CCR3 signaling in eosinophils, development MAG-dependent inhibition of neurite outgrowth, RhoA pathway, factors promoting cardiogenesis in vertebrates, antioxidant action of vitamin-C, transendothelial migration of leukocytes, actin nucleation by ARP-WASP complex, cardiac muscle contraction, hypertrophic cardiomyopathy (HCM), dilated cardiomyopathy, and viral myocarditis pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P, Single-Cell Western
Species: Hu
Applications: ICC, IHC
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Xp
Applications: ELISA, Flow, ICC/IF, IHC, WB
Species: Bv, Gt, Hu, Mu, Po, Rb, Rt, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Publications for MYH7 Recombinant Protein Antigen (NBP2-52737PEP) (0)
There are no publications for MYH7 Recombinant Protein Antigen (NBP2-52737PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MYH7 Recombinant Protein Antigen (NBP2-52737PEP) (0)
There are no reviews for MYH7 Recombinant Protein Antigen (NBP2-52737PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for MYH7 Recombinant Protein Antigen (NBP2-52737PEP) (0)
Additional MYH7 Products
Research Areas for MYH7 Recombinant Protein Antigen (NBP2-52737PEP)
Find related products by research area.
|
Blogs on MYH7