MYF6 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MYF6 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYF6
  
  

  Source: E.coli

  Amino Acid Sequence: FETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MYF6
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25003It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MYF6 Recombinant Protein Antigen

• bHLHc4BHLHC4
• Class C basic helix-loop-helix protein 4
• MRF4
• MRF4myogenic factor 6
• Muscle-specific regulatory factor 4
• myf-6
• myogenic factor 6 (herculin)

Background

MYF6 (Myogenic factor 6 or herculin) is a 242 amino acid basic helix-loop-helix DNA binding protein that is involved in muscle differentiation. It induces fibroblasts to differentiate into myoblasts. Defects in MYF6 may be a cause of centronuclear myopathy type 3. It may also play a role in muscular dystrophy, rhabdomyosarcoma, myopathy, centronuclear myopathy, alveolar soft part sarcoma and myasthenia gravis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYF6